(data stored in ACNUC7421 zone)

EMBL: CP001854.PE16

CP001854.PE16        Location/Qualifiers
FT   CDS_pept        19109..20545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0016"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sat:SYN_00551 cell elongation specific D,D-
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48452"
FT                   /db_xref="GOA:D3EYP8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADB48452.1"
FT                   /translation="MRLFLAIVLLFVILIAWTSRWSVFGAEALRENPLDKRPLFAGLQV
FT                   KRGAITAAGGEVLAKSVRVRRKGGSIYEREYPTDSLFGHPVGYANLLFGQLSGLERSRN
FT                   DELTGTTSELNSIVDQLQGKRRAGNTVVTTLDADAQRVATDALGGQKGAIVAIEPKTGA
FT                   VKTMVSSPGYDPNDVRDPDALSALNRDTENAPLLDRVTQGTYPPGSTFKVVTASAAIDS
FT                   GQFTPDSVLNGDTGKVISGTPLNNDSNVSYGDIDLRTALKNSVNVVWAQVAERLGKQTM
FT                   ADYMDRFGFYRLPPLDYPKDQMIASGERGPNGRLIPVTSPLVDVGRMAIGQDKLTVTPL
FT                   QMAMVVSAVANGGKLMKPHLTDKVVDPDGRTVDTIEPETWSEPISSQTAAEMTTMMRSV
FT                   VDDGTGTAVQIPGLDIAAKTGTAQVGAPGSGLTQPWFVAFAPANDPQIALAVTVERSQG
FT                   GSGGTVAAPIARQVFESLLR"
     atgcgcctgt tcctggcgat cgtgctgctg ttcgtgatcc tgatcgcgtg gacgtcgcgc        60
     tggtcggtct tcggggcgga ggcgctgcgc gagaacccgc tcgacaagcg cccgctgttc       120
     gccgggctgc aggtcaagcg cggcgcgatc acggcggccg gcggcgaggt gctcgcgaag       180
     tcggtcagag tccgccgcaa gggcgggtcg atctacgagc gcgagtaccc gaccgacagc       240
     ctcttcggcc atccggtcgg ctacgcgaac ctgctgttcg gccagctgtc gggcctggag       300
     cggtcgcgca acgacgagct gacggggacg acgagcgagc tgaactcgat cgtcgaccag       360
     ctgcaaggaa agcggcgcgc gggcaacacc gtcgtgacga cgctcgacgc cgacgcgcag       420
     cgcgtcgcga ccgacgcgct cggcggccag aagggcgcga tcgtcgcgat agagccgaag       480
     acgggcgcgg tcaagacgat ggtcagcagc cccggctacg accccaacga cgtcagagac       540
     ccggacgcgc tcagcgccct caacagggac accgagaacg cgccactgct cgaccgcgtg       600
     acgcagggca cctatccgcc cggctcgacg ttcaaggtcg tgaccgcgtc cgccgcgatc       660
     gactccggcc agttcacgcc cgactcggtc ctcaacggcg acaccggcaa ggtgatctcc       720
     ggcacgccgc tcaacaacga ctcgaacgtc agctacggcg acatcgacct gcggacggcg       780
     ctgaagaact cggtcaacgt cgtctgggcg caggtcgccg agagactcgg caagcagacg       840
     atggccgact acatggacag attcggcttc tacagactgc cgccgctcga ctacccgaag       900
     gaccagatga tcgcgagcgg cgagcgtggg ccgaacggcc ggctgatccc ggtcacgagc       960
     ccgctcgtag atgtcgggcg gatggcgatc ggccaggaca agctgacggt cacgccgctg      1020
     cagatggcga tggtcgtctc cgccgtcgcc aacggcggca agctgatgaa gccgcacctg      1080
     accgacaagg tcgtcgaccc ggacgggcgc accgtcgaca cgatcgagcc ggagacgtgg      1140
     agcgagccga tctcctccca gacggccgcc gagatgacga cgatgatgcg cagcgtggtc      1200
     gacgacggca ccggcacggc cgtgcagatc cccgggctcg acatcgcggc gaagaccggc      1260
     accgcgcagg tcggcgcgcc cggctccggg ctgacgcagc cgtggttcgt cgcgttcgcg      1320
     cccgcgaacg acccgcagat cgcgctcgcc gtcaccgtcg aacgcagcca gggcggctcc      1380
     ggcggcaccg tcgccgcccc gatcgcccgc caggtcttcg agagcctgct gagatga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page