(data stored in ACNUC7421 zone)

EMBL: CP001854.PE161

CP001854.PE161       Location/Qualifiers
FT   CDS_pept        complement(157972..159399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0161"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   xac:XAC1811 N-glycosyltransferase PgaC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48597"
FT                   /db_xref="GOA:D3F519"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F519"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48597.1"
FT                   /translation="MAADRTTSTTDATRSRSPHEDGTKRPARRPSHPRRLRGRLGRQQR
FT                   KAQQRQASGTALVPYEQPTTEAAPQPRQGISNKLTQLYWNASMAMHRFQNRPPKTRTAK
FT                   IVVVVPAHNEEGTIAGVLQALLAQTRRPERIVVVADNCTDKTVEIARRFGRRVTVIETV
FT                   GNRDRKVGALRMAWQQYVAYGYDYMLGVDADTILSPDSLAALEDELEESPKAGGVMARY
FT                   TFDPDLGQSRWARLLVRMQRLEFASWTIDILHRKRNTYVLGGQATLFRVSALQQIVDEE
FT                   RRLSPWDPEAQVEDMELTWMLSTRDWETKVSATARAYAGPMLTIRSLWAQRRKWDEGMI
FT                   RLLLGSKIGATTMYPWRVQLKNGINALTRGLFVLLLGTSLLIGAFEWNWIWVVPPILAA
FT                   LLNFKHARKVPNHTRLDLFLAGTLVMVEIYLWFRLLAWVTSWATVVVGIRRDGWARQYK
FT                   AEGLPAGQTMIATGEVV"
     atggccgcag atcgcacgac ttccaccacc gacgcgacgc gctcgcgcag tcctcacgag        60
     gacggcacga agcgccccgc gcgccggccg agccaccccc gccgattgcg gggccgcctc       120
     ggccgtcagc agcgcaaggc gcagcagcgc caggcgtcag gcaccgcgct ggtcccgtac       180
     gagcagccca cgaccgaggc ggcgccgcag cctcgtcagg gcatctcgaa caagctgacc       240
     cagctctact ggaacgcctc gatggcgatg caccggttcc agaaccgccc gccgaagacg       300
     cgcaccgcca agatcgtcgt cgtcgtgccc gcgcacaacg aggaggggac gatcgccggc       360
     gtgctgcagg cgctgctggc gcagacgcgc cggccggagc ggatcgtcgt ggtggccgac       420
     aactgcaccg acaagacggt cgagatcgcg cgccgcttcg gccgccgcgt gaccgtgatc       480
     gagacggtcg gcaacagaga ccgcaaggtc ggtgcgctgc ggatggcctg gcagcagtac       540
     gtcgcctacg gctacgacta catgctcggc gtcgacgccg acacgatcct ctcgcccgac       600
     tcgctcgcgg cgctggagga cgagctggag gagagcccca aggccggcgg cgtgatggcg       660
     cgctacacgt tcgacccgga cctcggccag tcgcgctggg cgcgcctgct cgtgcggatg       720
     cagcggctcg agttcgcctc gtggacgatc gacatcctcc accgcaagcg caacacgtac       780
     gtgctcggcg gtcaggcgac gctgttccgc gtcagcgcgc tgcagcagat cgtcgacgag       840
     gagcgccgtc tctccccgtg ggaccccgag gcgcaggtcg aggacatgga gctgacgtgg       900
     atgctctcga cgcgcgactg ggagacgaag gtctccgcga ccgcgcgcgc ctacgccggg       960
     ccgatgctga cgatcagatc gctgtgggcg cagcgccgga agtgggacga gggcatgatc      1020
     cgcctgctgc tcggctcgaa gatcggcgcg acgacgatgt acccgtggcg ggtgcagctc      1080
     aagaacggga tcaacgcgct cacgcgcggc ctgttcgtgc tgctgctcgg cacctcgctg      1140
     ctgatcggcg cgttcgagtg gaactggatc tgggtcgtgc cgccgatcct cgcggcgctg      1200
     ctgaacttca agcacgcccg caaggtgccc aaccacacgc ggctcgacct cttcctcgcg      1260
     ggcacgctcg tgatggtcga gatctacctc tggttccgcc tgctcgcgtg ggtgacctcg      1320
     tgggcgaccg tcgtcgtcgg catccgccgc gacggctggg cccgccagta caaggccgag      1380
     ggactgcccg ccggccagac gatgatcgca accggagagg tggtctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page