(data stored in ACNUC7421 zone)

EMBL: CP001854.PE162

CP001854.PE162       Location/Qualifiers
FT   CDS_pept        159505..160281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0162"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: gsu:GSU0681 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48598"
FT                   /db_xref="GOA:D3F520"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F520"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48598.1"
FT                   /translation="MGARQMRKRRPKNRSFDMALKQSGTIADISKVKRPAPTLSVPRPM
FT                   ADAAVVQAAVETERAHTRAWLHDSVLQVLEYIASGGYADEPDAAALSRVAADAAAELRA
FT                   YVEGDTAQEAAGGHGELCERLCIVVAEERALADHEIGLIFGEQERELTGRQAEQLAAAT
FT                   AEALRNTRKHARATRALVTCDVVGAAATVIVSDDGAGFDVAGVRRGGAGLRESIVGRLA
FT                   REGGAATIRSRPGHGTRVTLRLPLDAGADAEQGRAA"
     atgggggcgc gccaaatgcg aaaacgtcgg cccaagaacc ggtcgttcga tatggcgctc        60
     aagcagtcgg gcaccattgc cgacatctcc aaggtgaaac gtcccgctcc caccctgtcg       120
     gtcccccgtc cgatggcgga tgccgccgtc gtgcaggcgg cggtcgagac cgagcgtgcg       180
     cacacgcggg cgtggttgca cgactccgtc cttcaggtgc tggagtacat cgccagcggc       240
     ggctatgccg acgagcccga cgccgccgcg ctgagccgcg tcgccgccga cgcggccgcc       300
     gagctgcgcg cgtacgtcga gggcgacacc gcgcaggagg cggcgggcgg ccacggcgag       360
     ctgtgcgagc ggctctgcat cgtcgtcgcg gaggagcgtg cgctcgccga ccacgagatc       420
     gggctgatct tcggcgagca ggagcgcgag ctgaccggca ggcaggccga gcagctcgcc       480
     gccgcgacgg ccgaggcgct gcgcaacaca cgcaagcacg cccgcgcgac gcgcgcgctc       540
     gtcacgtgcg acgtcgtcgg cgccgccgcc acggtgatcg tcagcgacga cggcgccggc       600
     ttcgacgtcg ccggcgtgcg ccgcggcggc gccggcctgc gcgagtcgat cgtcggccgg       660
     ctcgcgcgcg agggcggcgc cgccacgatc cgctcacggc ccgggcacgg cacgcgcgtg       720
     acgctgagac tgccgctcga cgcaggcgcc gacgcggagc agggacgggc ggcgtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page