(data stored in ACNUC7421 zone)

EMBL: CP001854.PE163

CP001854.PE163       Location/Qualifiers
FT   CDS_pept        160278..160919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0163"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; LexA DNA-binding
FT                   domain protein; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48599"
FT                   /db_xref="GOA:D3F521"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F521"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48599.1"
FT                   /translation="MNIRVLVVEDFPLVRDGVVDALSRDPGIEVVGAAVDGREGLALAH
FT                   ELRPDVIVLDLHMPEIGGMMVLERLRTELPSAKSIVMTATEKAEPLLDAIAAGAAGYLT
FT                   KRTSGEELRQAILTVHGGGSVIAPQLAPHLLQAYSRASTGEAPDVRKKLTATEHEVLRL
FT                   VAQGMTDRQIAERLFVSPRTVQNHLARIREKTSMRRRSDLARWAVLHAVY"
     gtgaacatcc gggtcctcgt cgtcgaggac ttcccgctcg tccgcgacgg cgtcgtggac        60
     gcgctctcgc gggatcccgg gatcgaggtc gtcggtgccg ccgtcgacgg gcgtgagggc       120
     ctcgcgctcg cgcacgagct gcgtcccgac gtgatcgtgc tcgacctgca catgccggag       180
     atcggcggca tgatggtgct ggagcggctg cggaccgagc tgccgtcggc caagtcgatc       240
     gtgatgaccg cgaccgagaa ggcggagccg ctgctcgacg cgatcgcggc cggcgcagcc       300
     ggctacctga ccaagcgcac cagcggcgag gagctgcgcc aggcgatcct gaccgtccac       360
     ggtggtggct ccgtgatagc gccgcagctc gcgccgcacc tgctgcaggc gtactcgcgc       420
     gcgtcgaccg gcgaggcgcc cgacgtgcgc aagaagctga ccgcgaccga gcacgaggtg       480
     ctgcggctcg tcgcgcaggg gatgaccgac agacagatcg ccgagcggtt gttcgtctcg       540
     ccccgcaccg tccagaacca cctcgcgcgc atacgcgaga agacgagcat gcggcgccgc       600
     tcggacctcg cgcgctgggc cgtcctgcac gctgtctatt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page