(data stored in ACNUC7421 zone)

EMBL: CP001854.PE164

CP001854.PE164       Location/Qualifiers
FT   CDS_pept        160919..161512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_1882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48600"
FT                   /db_xref="GOA:D3F522"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:D3F522"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48600.1"
FT                   /translation="MSALADRTHGRWPWLAAAAAPASTVALIAVRDRLGEDVRWALWTA
FT                   PAALLWHQTEEWFWPGGFLPWFNREVIGSEQDEFPITRGGGLVINVAIGWGVTAAAARG
FT                   GMRTPALGASALAVNVANGAMHVALAVRRRERNPGAVTSALLFLPLGVAGLAAIARDPR
FT                   GGTRPVVIGLAVGAASGVGTFAAMRRRLARAAAR"
     atgagcgcgc tggccgaccg cacgcacggc cgctggccgt ggctcgccgc cgccgcggcg        60
     ccggcgtcga ccgtcgcgct gatcgccgtc cgcgaccggc tcggcgagga cgtgcgctgg       120
     gcgttgtgga ccgcgccggc cgcgctgctc tggcatcaga cggaggagtg gttctggccg       180
     ggtggcttcc tgccgtggtt caaccgcgag gtgatcggca gcgagcagga cgagttcccg       240
     atcacgcgcg gcggcgggct cgtcatcaac gtcgcgatcg gatggggcgt gaccgccgcc       300
     gccgcgcgcg gcgggatgcg cacgcccgcg ctcggtgcga gcgcgctggc ggtcaacgtc       360
     gccaacggcg cgatgcacgt cgcgctcgcg gtgcggcggc gggagcgcaa ccccggcgcg       420
     gtcacctccg cgctgctgtt cctgccgctc ggcgtcgccg ggctcgccgc gatcgcgcgc       480
     gacccgcgcg gcggcacgcg gccggtcgtg atcggcctcg ccgtcggcgc cgcgtccggg       540
     gtggggacgt ttgccgcgat gcgccgccgg ctggcgcgcg ccgccgcgcg ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page