(data stored in ACNUC7421 zone)

EMBL: CP001854.PE165

CP001854.PE165       Location/Qualifiers
FT   CDS_pept        161543..161971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0165"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: oan:Oant_0062
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48601"
FT                   /db_xref="GOA:D3F523"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3F523"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB48601.1"
FT                   /translation="MPTAFVHTCIRARDVEASLRFYELLGFERRGRLVFESAYNIYMGL
FT                   PGDGDTFELTVNVGRTEPYDLGDGYNHMALTVDDLDALLATLAQAGIEPEKPPYAPGGR
FT                   DEVGRICFVADPDGYRVELIDGGAFATPQDPPHPAGGA"
     atgcccaccg ccttcgtcca cacctgcatc cgcgcgcgcg acgtcgaggc ctcgctgcgc        60
     ttctacgagc tgctcggatt cgagcggcgc gggcggctcg tcttcgagtc ggcctacaac       120
     atctatatgg ggttgcccgg agatggcgac acgttcgagc tgaccgtcaa tgtcggccgc       180
     accgagccgt acgacctcgg cgacggctac aaccacatgg cgctcacggt cgacgatctc       240
     gacgcgctgc tggcgacgct cgcgcaggcg gggatcgagc ccgagaagcc gccgtacgcg       300
     cccggcgggc gcgacgaggt cggccgcatc tgcttcgtcg ccgaccccga cggctaccgc       360
     gtcgagctga tcgatggcgg cgccttcgcg acgccgcagg acccgccgca cccggccggc       420
     ggcgcgtag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page