(data stored in ACNUC7421 zone)

EMBL: CP001854.PE166

CP001854.PE166       Location/Qualifiers
FT   CDS_pept        162096..163763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0166"
FT                   /product="Protein of unknown function DUF1800"
FT                   /note="PFAM: Protein of unknown function DUF1800; KEGG:
FT                   bcj:BCAL2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48602"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:D3F524"
FT                   /inference="protein motif:PFAM:PF08811"
FT                   /protein_id="ADB48602.1"
FT                   /translation="MRRSSKPSKQRRPRRKPCRRPARGKRGKQPASCRRAPAKRRAPAS
FT                   RAPAPKRPPRRAPDAESPHPALPTIPNGTPVPGLPPEAAPPTPPPGEQPPGTPPPEQPP
FT                   SVPRPPGLLRYDGPFGVAQATRLQWRAGFGPRRGEAAQLAALGLDGAVTALTRASGPAQ
FT                   LVGPAPYTEFDDRLEPGVRFEHDHLAWLDRMVRSTQPFVERMALLWHDWFGISDDNVGQ
FT                   YTLLARHVELFRTHGRGSFRDLARMVMEDGAMLVRLNGVGNQRHRPNENFARELMELFT
FT                   LGPDRGAYAERDIREAARGLTGYEGDFRQPNGWQSFWFDPQWHDTTNKEIFGRVAPYDP
FT                   DDVVDACITHRLHPSFFVLKLWSAFVAQPPPPDQRVLLERLYVERGHAVMPVVEAILTH
FT                   PAVYEGPPLVKPPVVYAAGLMRALGAGIEAIGWTGYTANAGQRLHYPPTIAGWREDRWL
FT                   DTSTLHARWKLADLALKGRHLTAESPYPADETPQQAVAMALRFWDDPPLHGDTVAVLVE
FT                   TAERIGRLSTGVSASGRNALRQTILRHLAITSPDAQVC"
     atgcgcagat cctccaagcc atcgaagcag cgccgcccgc gcagaaagcc gtgccgcaga        60
     ccggcgcgcg gcaagcgcgg caagcagccg gccagctgcc gcagagcgcc ggcgaagcgc       120
     agagcgccgg cgagcagagc gccggcgccg aagcgcccgc cgcgcagagc gcccgacgcc       180
     gagtcgccgc atcccgcgct gccgacgatc ccgaacggca cgccggtccc ggggctgccg       240
     ccggaggcgg cgccgcccac gccgccgccc ggcgagcagc cgccgggcac gcctccgccg       300
     gagcagccgc cgtccgtccc gcggccgccc ggcctgctcc gctacgacgg cccgttcggc       360
     gtcgcgcagg cgacgcggct gcagtggcgc gccggcttcg ggccacgtcg gggcgaggcg       420
     gcgcagctgg ccgcgctcgg gctcgacggc gcggtcacgg cgctcacgcg cgccagcggt       480
     cccgcccagc tcgtcggccc ggcgccgtac accgagttcg acgacagact cgagcccggc       540
     gtcagattcg agcacgacca cctcgcctgg ctcgaccgga tggtgcgctc gacgcagccg       600
     ttcgtcgagc ggatggcact gctgtggcac gactggttcg gcatcagcga cgacaacgtc       660
     ggccaataca cgctgctggc gagacacgtc gagctctttc gcacgcacgg ccgcggctcg       720
     ttccgcgacc tcgcgcggat ggtgatggag gacggcgcga tgctcgtccg cctcaacggc       780
     gtcggcaacc agcgccaccg cccgaacgag aacttcgcgc gcgagctgat ggagctgttc       840
     acgctcggcc ccgaccgtgg tgcgtacgcc gagcgcgaca tccgcgaggc cgcgcgcggt       900
     ctgaccggct acgagggcga cttccggcag ccgaacggct ggcagagctt ctggttcgac       960
     ccgcagtggc acgacacgac gaacaaggag atcttcggca gagtcgcgcc gtacgatccc      1020
     gacgacgtcg tcgacgcctg catcacgcac cgcctgcacc cgtcgttctt cgtgctgaag      1080
     ctgtggtcgg cgttcgtcgc gcagccgccg ccgcccgacc agcgggtcct gctcgaacgg      1140
     ctctacgtcg agcgcgggca cgcggtcatg ccggtcgtcg aggcgatcct cacgcacccc      1200
     gcggtctacg aggggccgcc gctcgtcaag ccgccggtcg tctatgccgc cgggctgatg      1260
     cgcgcgctcg gcgccgggat cgaggcgatc ggctggaccg gctacaccgc caacgccggc      1320
     cagcggctcc actacccgcc gacgatcgcc ggctggcgcg aggaccgctg gctcgacacc      1380
     tcgacgttgc acgcccgctg gaagctcgcc gacctcgcgc tcaagggccg tcacctgacc      1440
     gccgagagcc cgtacccggc ggacgagaca ccgcagcagg cggtcgcgat ggcgctgcgc      1500
     ttctgggacg acccgccgct ccacggcgac accgtcgcgg tgctggtcga gaccgccgag      1560
     cggatcggcc gcctctcgac cggcgtcagc gcgagcgggc gcaacgcgct gcgccagacg      1620
     atcctccgcc atctcgcgat cacgtccccc gacgcacagg tctgctga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page