(data stored in ACNUC7421 zone)

EMBL: CP001854.PE167

CP001854.PE167       Location/Qualifiers
FT   CDS_pept        163763..165127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0167"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   mxa:MXAN_6390 Tat pathway signal sequence domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48603"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:D3F525"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADB48603.1"
FT                   /translation="MHRSCDEFTRASAARSGRATAGDGLPAIEPGMPLPAGTGMTRRSL
FT                   LLGGAGLALTIFGGRALAPQAFAEGLDAAAAAAPDAPVIVSVFLSGGVDSIALLAPVED
FT                   PRYTRALRPSLFVEPAATLPASGTTAMRWHPSAAAFKELHDRGRLTVFPAIGYEHANGS
FT                   HFTSRHFYEVGATDPDSATGWLGRYLDIVGEDHNPVQGFTVGPTLSPSLASARVAVAAA
FT                   EAPQAYDFVSPGIEGGPFKDELVRGHAAIGRLTSTDPVLGPARAMHRDAADLRAALSAP
FT                   LPGTSVSYPAGRLGQRLRDVVRLLAAGLPIRCATVDATADFDTHAGQRDTFTEQIAEAG
FT                   AALAAFQADLESRPGLADRVLTIAWSEFGRRPEENGSAGTDHGAGGVGFLLGTRVRGGW
FT                   VGEFPGLSRLDVEGNLLPTSDFRALYASVIEQWMGQDAAQVIPEAARFQRYALLR"
     atgcaccgct cctgcgacga gttcacccgc gcgagcgcag cccgcagcgg ccgtgccacc        60
     gccggcgacg gcctccccgc gatcgagccg gggatgccgc tcccggccgg caccgggatg       120
     acgcgccgct cgctgctgct cggcggagct ggcctcgcgc tgacgatctt cgggggccgc       180
     gcgctcgccc cgcaggcgtt cgccgagggg ctcgacgccg ccgcggcggc cgcccccgac       240
     gcgcccgtga tcgtctccgt cttcctctcc ggaggcgtcg actcgatcgc gctgctggcg       300
     ccggtcgagg atccgcgcta cacgagagcg ctgcgcccgt cgctgttcgt cgaaccggcc       360
     gccacgctgc ccgcgagcgg gacgaccgcg atgcgctggc atccgtcggc agcggcgttc       420
     aaggagctgc acgaccgcgg ccggctgacc gtcttcccgg cgatcggcta cgagcacgcg       480
     aacggctcgc acttcacctc gcgccacttc tacgaggtcg gcgcgaccga cccggacagc       540
     gcgaccggct ggctcggccg ctacctcgac atcgtcggcg aggaccacaa cccggtccag       600
     ggcttcacgg tcgggccgac gctgtcgccg tcgctcgcga gcgcgcgggt cgcggtcgcc       660
     gcggcggagg cgccgcaggc gtacgacttc gtctcgcccg ggatcgaggg cgggccgttc       720
     aaggacgagc tggtgcgcgg ccacgcggcg atcggccgcc tgacgtcgac cgacccggtg       780
     ctcggcccgg cgcgcgcgat gcaccgcgac gcggccgacc tgcgcgcggc gctgtcggcg       840
     ccgctgccgg gcacgtcggt cagctacccg gcgggcagac tcgggcagcg gctgcgcgac       900
     gtcgtgcgcc tgctcgcggc cgggctgccg atccgctgcg cgacggtcga cgcgaccgcc       960
     gacttcgaca cgcacgccgg ccagcgcgac acgttcaccg agcagatcgc cgaagccggc      1020
     gcggcgctcg cggcgttcca ggccgacctg gagtcgcgcc ccggcctcgc cgatcgcgtg      1080
     ctgacgatcg cctggagcga gttcgggcgc cgacccgagg agaacggctc ggccggcacc      1140
     gaccacggcg ccggcggcgt cggcttcctg ctgggtacgc gcgtgcgcgg cggctgggtc      1200
     ggcgagttcc ccggtctcag cagactcgac gtcgagggca acctgctgcc gacgagcgac      1260
     ttccgcgcgc tctacgcgag cgtgatcgag cagtggatgg gccaggacgc cgcgcaggtg      1320
     atcccggaag cggcgcgctt tcagcgctac gcgctcctcc gctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page