(data stored in ACNUC7421 zone)

EMBL: CP001854.PE168

CP001854.PE168       Location/Qualifiers
FT   CDS_pept        165183..166172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0168"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48604"
FT                   /db_xref="GOA:D3F526"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D3F526"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADB48604.1"
FT                   /translation="MTSSDAPVKGYQLKDISPRAWQHPADRAATAALASVPYLDKVVRM
FT                   LIQLGYERALRQASLGASVRLGEQQLPDVWSDHVFAYSTLDIASTPPLYVMQTPEPNAF
FT                   AIGAKNPIVVVQSELLQLLDAPQRRAVFAHEAAHILADHQLYRTALLILLRLTAAARMP
FT                   LPLMPVRTALLEWYRATELSCDRAAALVTRDPLAVCRTLMSITAGTMVDELDLDAFMTQ
FT                   SMDYAERGNGIERLTRLLLDLGLTHPLPVRRTRELMLWVRSGEFDRIVGGDYVKRDDPV
FT                   SVRAESGEAVSFYSDRFKDAFRDAGETIGQGGQQLADWLRKAKDDIGS"
     atgacctcgt ctgacgcacc cgtcaagggc taccagctga aggacatctc gccgcgtgcc        60
     tggcagcacc cggccgaccg cgccgctacc gccgcgctgg cctcggtgcc gtacctcgac       120
     aaggtcgtgc ggatgctgat ccagctcggc tacgagcgcg cactgcggca ggcgtcgctc       180
     ggcgcctcgg tgcggctcgg cgagcagcag ctgcccgacg tctggtccga tcacgtcttc       240
     gcctactcga cgctcgacat cgcctcgacg ccgccgctct acgtcatgca gacgcctgag       300
     ccgaacgcgt tcgcgatcgg cgcgaagaac ccgatcgtcg tcgtccagtc ggagctgctg       360
     cagctgctcg acgcgccgca gcggcgtgcc gtcttcgcgc acgaggcggc gcacatcctc       420
     gccgaccacc agctctaccg caccgcgctg ctgatcctgc tgcggctgac tgccgccgcg       480
     cgcatgccgc tgccgctgat gccggtccgc acggcgctgc tggagtggta ccgcgcgacc       540
     gagctgagct gcgaccgcgc cgccgcgctc gtcacgcgcg acccgctcgc ggtctgccgc       600
     acgctgatgt cgatcaccgc cggcacgatg gtcgacgagc tcgacctcga cgccttcatg       660
     acgcagagca tggactacgc cgagagaggc aacgggatag aacgcctgac gcggctgctg       720
     ctcgacctcg gcctgacgca cccgctgccg gtgcggcgca cgcgcgagct gatgctgtgg       780
     gtccgctccg gcgagttcga ccgcatcgtc ggtggcgact acgtcaagcg cgacgatccg       840
     gtcagcgtca gagcggagag cggcgaggcg gtctcgttct acagcgaccg cttcaaggac       900
     gccttccgcg acgcgggcga gacgatcggc caaggcggcc agcagctcgc cgactggctg       960
     aggaaggcga aggacgacat cggctcgtaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page