(data stored in ACNUC7421 zone)

EMBL: CP001854.PE169

CP001854.PE169       Location/Qualifiers
FT   CDS_pept        166235..167236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0169"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: dac:Daci_4435 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48605"
FT                   /db_xref="GOA:D3F527"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F527"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB48605.1"
FT                   /translation="MGAATGEVIRLGIAGGGIMGERIAATVARLDGIEVRAIADANPAQ
FT                   RERLGQAFGCSAVATWEELVAGGEVDAVYVGLPNHLHAAAACAAAEAGLHVLIDKPLCE
FT                   TLAEGERILAAVERAGVRLMVGFSHRFHVELTTAKRMLAAGELGAPVLATDIIVDSAPD
FT                   GPDWYWDRAAGGGVVQLQMHHSFDRLAWLLDSPIVRVQASVHERALRGAEPADVAAAVT
FT                   LTFANGAVGTSAASFVTGYDGDGIVELAIQGTHGHVRIETWRSIEAQTARSAFDQHQRR
FT                   DDWLGAEVAEFAAAIRERREPSVTGRDGLRALRVALAAFESARTGRAVDITP"
     atgggagctg cgactggcga ggtgatccgg ctcgggatcg ccggcggcgg gatcatgggc        60
     gagcggatcg ccgcgacggt ggcgcgactc gacgggatcg aggtgcgcgc gatcgcggac       120
     gcgaacccgg cgcagcgcga gcggctgggg caggcgttcg gctgctccgc ggttgcgacg       180
     tgggaggagc tggtcgccgg cggcgaggtc gacgcggtct acgtcggcct gcccaaccac       240
     ctccacgccg cggccgcgtg cgctgccgcg gaggcggggc tgcacgtgct gatcgacaag       300
     ccgctgtgcg agacgctggc ggagggcgag cggatcctcg cggcggtgga gcgcgcgggc       360
     gtgcggctga tggtcggctt cagtcaccgc ttccacgtcg agctgacgac cgccaagcgg       420
     atgctcgccg ccggagagct gggcgcgccg gtgctcgcga ccgacatcat cgtcgacagc       480
     gctcccgacg gtcccgactg gtactgggat cgcgcggccg gcggcggcgt cgtgcagctg       540
     cagatgcacc acagcttcga ccgcctcgcc tggctgctcg acagcccgat cgtgcgcgtc       600
     caggcgagcg tgcacgagcg cgctctgcgc ggcgccgagc ccgccgacgt cgccgccgcg       660
     gtgacgctga cgtttgccaa cggcgccgtc ggcacctccg ccgcctcgtt cgtgaccggc       720
     tacgacggcg acgggatcgt cgagctggcg atccagggca cgcacggcca cgtccgcatc       780
     gagacgtgga gatcgatcga ggcgcagacc gcgcgcagcg cgttcgacca gcaccagcgc       840
     cgcgacgact ggctcggcgc cgaggtcgcc gagttcgccg ccgcgatccg cgagcgccgc       900
     gagccgtccg tcaccggccg cgacggcctg cgcgcgctgc gcgtcgcgct cgccgcgttc       960
     gagtccgcgc gcacggggcg cgcggttgac ataacgccgt ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page