(data stored in ACNUC7421 zone)

EMBL: CP001854.PE17

CP001854.PE17        Location/Qualifiers
FT   CDS_pept        20542..22518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0017"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: scl:sce2470
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48453"
FT                   /db_xref="GOA:D3EYQ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48453.1"
FT                   /translation="MTEIAPDTVIDSRYKVLSRIGAGGMAEVFCAQDQSLGRKVALKLL
FT                   YERFASDAEFVERFRREASSAASLQHPNVVGIYDRGRWDGTYYIAMEYLPGRSLKEVIQ
FT                   QDAPIDHVRAIDLTIQILKAARFAHRRGIVHRDLKPHNVIVDDEDRAKVTDFGIARAGA
FT                   SDMTETGSIMGTAQYLSPEQAQGHAVSPQSDLYSVGVILFELLTGNVPFEAESAVTIAL
FT                   KHVSEPPPAPSAFDPSVPPELEAIVLWALEKDPAHRPQDADAFIQALEQARDQILGREA
FT                   PGQRTAMFAAGALAIPQADDGAPPAEEPPDAERSRRRPPWWAWVVAVLAVAGVVAAIVL
FT                   LTRPDQVAVPNVVGQQLQAATRRLERDGLEWRIENVNNDAEVGEVVDQSPRGRRRVEEG
FT                   TTVTLKVSRGPGTIDVPAVDGETVARATAILQNVGLTVGGTIDQNDASVPIGEVIRSSP
FT                   RAGENVERGSAVKLYVSTGPAQVAVPDVVGSTRDEAIATLTNAGFRYSTTEQESADADP
FT                   GDVISQDPGGGTDADPGSTLAIVIARAPPVEVPSVVGSGADDARAALEARGLVVRQSPV
FT                   DVTDPAQDGIVVDQRPAPGTSVADGAPVRIFVGRFVEPTTPPDGDGDDQGDNGDGGATD
FT                   PSDGDGNADQNGPVGRAQSRRPT"
     atgaccgaga tcgcccccga caccgtcatc gactcgcgct acaaggtgct ctcgcgcatc        60
     ggcgcgggcg gcatggcgga ggtcttctgc gcgcaggacc agtcgctcgg gcgcaaggtc       120
     gcgctgaagc tgctctacga gcgcttcgcc tccgacgccg agttcgtcga gcgtttccgc       180
     cgtgaggcgt cgagcgcggc gagcctccag caccccaacg tcgtcggcat ctacgaccgc       240
     ggcagatggg acggcaccta ctacatcgcg atggagtacc tgccgggccg ctcgctgaag       300
     gaggtgatcc agcaggacgc gccgatcgac cacgtccgcg cgatcgacct cacgatccag       360
     atcctcaagg cggcccgctt cgcgcaccgc cgcgggatcg tccaccgcga cctcaagccg       420
     cacaacgtga tcgtcgacga cgaggaccgc gcgaaggtca ccgacttcgg gatcgcgcgc       480
     gccggcgcct ccgacatgac cgagaccggc tcgatcatgg ggaccgcgca gtacctctcg       540
     cccgagcagg cgcagggcca cgccgtcagc ccgcagtccg acctctactc ggtcggcgtg       600
     atcctgttcg agctgttgac cgggaacgtg ccgttcgagg ccgagtcggc ggtgacgatc       660
     gcgctcaagc acgtctccga gccgccgccg gcgccgagcg cgttcgaccc gtcggtgccg       720
     ccggagctgg aggcgatcgt tctgtgggcg ctggagaagg acccggccca ccgcccgcag       780
     gacgccgacg cgttcatcca ggcgctggag caggcgcgcg accagatcct cggccgcgag       840
     gcgcccggcc agcggaccgc gatgttcgcc gccggagcac tcgcgatccc gcaggccgac       900
     gacggcgcgc cgcccgcgga ggagccgccc gacgccgagc gctccagacg ccgcccgccg       960
     tggtgggcgt gggtcgtcgc cgtgctcgcc gtcgccggcg tcgtcgccgc gatcgtcctg      1020
     ctgacgcggc ccgaccaggt cgccgtcccg aacgtcgtcg gtcagcaact gcaggcggcg      1080
     acgagacggc tggagagaga cgggctcgaa tggagaatcg agaacgtcaa caacgacgcg      1140
     gaggtcggcg aggtcgtcga ccagagcccc agaggccggc ggcgtgtcga ggagggcacg      1200
     acggtgacgc tgaaggtctc cagaggcccg ggcacgatcg acgtgccggc ggtcgacggc      1260
     gagacggtcg cgagggcgac ggcgatcctc cagaacgtcg gcctcacggt cggcggcacg      1320
     atcgaccaga acgacgcctc ggtgccgatc ggcgaggtga tccgcagctc gccgcgggcg      1380
     ggcgagaacg tcgagcgcgg cagcgcggtg aagctctacg tctcgaccgg accggcgcag      1440
     gtcgccgtgc ccgacgtcgt cggctcgaca cgcgacgagg cgatcgcgac gctgacgaac      1500
     gcgggcttca gatactcgac gaccgagcag gagtcggccg acgccgatcc cggcgacgtg      1560
     atctcgcagg atcccggcgg cgggaccgac gccgaccccg gcagcacgct cgcgatcgtg      1620
     atcgcgagag cgccgccggt cgaggtcccg agcgtcgtcg gcagcggcgc cgacgacgcg      1680
     cgcgcggcgc tggaggccag aggcctcgtc gtgcgccagt cgccggtcga cgtgaccgac      1740
     ccggcgcagg acgggatcgt cgtcgaccag agaccggcgc cggggacgag cgtcgccgac      1800
     ggcgcgccgg tgcggatctt cgtcggccgc ttcgtcgagc cgacgacgcc gccggacggc      1860
     gacggcgacg atcagggcga caacggcgac ggtggcgcga ccgacccctc cgacggcgac      1920
     ggcaacgccg accagaacgg tcccgtcggc agagcgcagt cgcgccggcc tacctga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page