(data stored in ACNUC7421 zone)

EMBL: CP001854.PE170

CP001854.PE170       Location/Qualifiers
FT   CDS_pept        complement(167254..168000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g21360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48606"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3F528"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48606.1"
FT                   /translation="MFHTLTACPVAVHEVPTSKVFFGRDDDAIHALTFYVWIVRGPNGV
FT                   GLVDAGLPPHADDLAALRTTGVYRDVVPLADVLAQHALTPADVDWCCITQPVTYHSGGV
FT                   LPELLPHAQVYLSRAGMTELLCDPPGHPPTEFFFTARSWAYLRELAIDGRLHVVDEPTE
FT                   VVPGVVFETTGGHHPGSAGVRVQTADGLAGILETAFVQENVDAEIPVGIAEDVARCRRE
FT                   IKRWKQTCDVVLADHEPALAERYRGR"
     atgttccaca cgctcaccgc gtgcccggtc gcggtccacg aggtgcccac ctcgaaggtc        60
     ttcttcggcc gtgacgacga cgcgatccac gcactgacgt tctacgtctg gatcgtccgc       120
     ggacccaacg gcgtcggcct cgtcgacgcc ggcctgccgc cgcacgccga cgacctcgcg       180
     gcattgcgta cgaccggcgt ctaccgcgac gtcgtcccgc tcgccgacgt gctcgcgcag       240
     cacgcgctga cgcccgccga cgtcgactgg tgctgcatca cgcagccggt cacgtaccac       300
     tccggcggcg tgctccccga gctgctgccg cacgcgcagg tgtacctctc gcgcgccggc       360
     atgaccgagc tgctgtgcga cccgcccggc cacccgccga ccgagttctt cttcaccgcg       420
     cgctcgtggg cctacctgcg cgagctggcg atcgacggac ggctgcacgt cgtcgacgag       480
     ccgaccgagg tcgtgcccgg cgtcgtcttc gagacgaccg gcggccacca ccccggctcg       540
     gccggcgtga gagtgcagac cgccgacggc ctcgccggga ttctcgagac ggcgttcgtg       600
     caggagaacg tcgatgccga gatccctgtc gggatcgccg aggacgtcgc ccgctgccgc       660
     cgcgagatca aacgttggaa gcagacgtgc gacgtcgtgc tcgccgacca cgagccggcg       720
     ctggcggagc gctaccgcgg ccgatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page