(data stored in ACNUC7421 zone)

EMBL: CP001854.PE171

CP001854.PE171       Location/Qualifiers
FT   CDS_pept        168198..169604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0171"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_B0080 ABC sugar transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48607"
FT                   /db_xref="UniProtKB/TrEMBL:D3F529"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB48607.1"
FT                   /translation="MHDHQDADARERADAEQGLKVSRATLLRGAAAAGIALPAMGLLSA
FT                   CGSGDDDSSASTSGDSGGTSEAYTGALAMTAWEAYPDQIRENLAAFKQQYGNQVDLTLI
FT                   PNIGYGPAIQTRLQGGQEIDAYYNFAYNSTKFVDAGWAKELNDLPGVEEMLADMFETSA
FT                   ARHKLPDGRIVSVPYFSAVHLLMYNEAQLRENGISAAPQSYSEIYDQCEKLKAGGVRAP
FT                   YAAYWTKQFSEEYFILYLVSEGIVPFDDDGNPTFQDDPKTEGVLDWWTSMYQDGLTARS
FT                   ILTDDPGKHVAAMAQGTSSFFTLHHYFLKEIRNARGPQSRNVTMSYRIPGSSGESLQIG
FT                   EVVQMGTKADGGRADRAWELLKFYGWKDKDGRYGTFISWAESAALLGPYPGLFKDPQFR
FT                   RAFPAYYDLGELERAFEASQVVPARVLPWYSSFQTKVGDRIQAMLLGQASVKDTISSLA
FT                   DDAKSFAAAG"
     atgcacgacc atcaggacgc cgacgcgcgt gagcgcgccg acgccgaaca gggcttgaag        60
     gtctcgcgcg ccacgctgct gcgcggtgct gcggccgccg gcatcgcgct gccggcgatg       120
     ggcctgctct ccgcctgcgg gagcggcgac gacgacagct cggccagcac gagcggcgac       180
     tccggcggca cctccgaggc gtacaccggc gcgctcgcga tgaccgcgtg ggaggcgtat       240
     ccggaccaga tcagagagaa cctggccgcg ttcaagcagc agtacggcaa ccaggtcgac       300
     ctcacactga tccccaacat cggctacggg cccgcgatcc agacgcgcct gcaaggcggc       360
     caggagatcg acgcctacta caacttcgcg tacaactcga cgaagttcgt cgacgccggc       420
     tgggcgaagg agctgaacga cctcccgggc gtcgaggaga tgctcgcgga catgttcgag       480
     acctccgccg cgcggcacaa gctgcccgac ggccgcatcg tctcggtccc gtacttctcc       540
     gccgtgcacc tcctgatgta caacgaggcg cagctgagag agaacggcat ctccgccgcg       600
     ccgcagtcgt acagcgagat ctacgaccag tgcgagaagc tcaaggccgg cggcgtccgc       660
     gccccctacg ccgcctactg gaccaagcag ttctcggagg agtacttcat cctctacctc       720
     gtctccgagg gcatcgtccc gttcgacgac gacggcaacc cgacgttcca ggacgacccc       780
     aagaccgagg gcgtcctcga ctggtggacg tcgatgtacc aggacggcct caccgccaga       840
     tcgatcctca ccgacgatcc cggcaagcac gtcgcggcga tggcgcaggg cacctccagc       900
     ttcttcaccc tgcaccacta cttcctcaag gagatccgca acgccagagg accgcagtcg       960
     agaaacgtca cgatgagcta ccggatcccc ggcagctcgg gcgagagcct ccagatcggc      1020
     gaggtcgtcc agatgggcac caaggccgac ggcggtcgtg ccgacagagc gtgggagctg      1080
     ctcaagttct acggctggaa ggacaaggac ggccgctacg gcacgttcat atcgtgggcc      1140
     gagtcggccg cgctgctcgg gccctacccc ggcctcttca aggacccgca gttcagaaga      1200
     gcgttccccg cctactacga cctcggcgag ctggagagag cgttcgaggc ctcgcaggtc      1260
     gtccccgccc gcgtgctgcc gtggtactcg tccttccaga cgaaggtcgg cgaccgcatc      1320
     caggcgatgc tgctcggcca ggcgagcgtg aaggacacga tctcgtcgct cgccgacgac      1380
     gcgaagagct ttgccgccgc aggctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page