(data stored in ACNUC7421 zone)

EMBL: CP001854.PE172

CP001854.PE172       Location/Qualifiers
FT   CDS_pept        169588..170562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0172"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: spe:Spro_2296
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48608"
FT                   /db_xref="GOA:D3F530"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F530"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48608.1"
FT                   /translation="MPPQADSTAAPRPPVRSQPARTRARRRSRRAAADRRFGLYLALPA
FT                   LIVVLGLIAWPAIQTLIYSLQRVALNGDTRWVGLRNFKLLIENPDFVHSLWLTAVYAIA
FT                   FLVVSTVLGLAFALLLNERFRGRWLARTLLIVPWACPWVIAGIIWKWFADGDVGALNGA
FT                   LYQIGVIDEYKAWLSSDTGALIISVLAAAWRQASFAALLFLAGLQTIPHELPEAAKVDG
FT                   ATAWQRFRLITLPWLKPVIVVVIVINVIFGFMQFDVIYALTQGGPGNATEVLSIFLYEQ
FT                   LFVYTNVGLGSATAVVLGVVALLIGLLFVKVIYRSDDVTKGVS"
     ttgccgccgc aggctgacag cacggcggca ccccggccac ccgtccggtc ccagccggcg        60
     cggacgcgag cgcgacgtcg ctcgcgccgc gccgcggcgg acaggcggtt cggcctctac       120
     ctggcgctgc ctgcgctgat cgtcgtgctc ggtctgatcg cctggccggc gatccagacg       180
     ctgatctact cgctccagag agtcgcactc aacggcgaca cgagatgggt cgggctcaga       240
     aacttcaagc tgctgatcga gaacccggac ttcgtccact cgctgtggct gacggccgtc       300
     tacgcgatcg cgttcctggt cgtctcgacc gtgctcggcc tcgcattcgc gctgctgctg       360
     aacgagcgct tccgcggccg ctggctcgcg cgcacgctgc tgatcgtccc gtgggcgtgc       420
     ccgtgggtga tcgccggcat catctggaag tggttcgccg acggcgacgt cggcgcgctc       480
     aacggcgcgc tttaccaaat cggcgtgatc gacgagtaca aggcgtggct gtcgagcgac       540
     accggcgcgc tgatcatctc cgtgctcgca gccgcatggc gtcaggcgtc gttcgctgcg       600
     ctgctgttcc tcgccggcct gcagacgatc ccgcatgagc tgccggaggc ggcgaaggtc       660
     gacggcgcga ccgcgtggca gcgcttccgc ctgatcacgc tgccgtggct caagcccgtg       720
     atcgtcgtcg tgatcgtcat caacgtgatc ttcggcttca tgcagttcga cgtcatctac       780
     gcgctgacgc agggcggtcc cggcaacgcg accgaggtgc tgtcgatctt cctctacgag       840
     caactgttcg tgtacacgaa cgtcggcctc ggctccgcca ccgcggtggt gctcggcgtc       900
     gtcgcgctgc tgatcggact gctgttcgtg aaagtgatct accgctccga cgacgtgacg       960
     aagggcgtct catga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page