(data stored in ACNUC7421 zone)

EMBL: CP001854.PE173

CP001854.PE173       Location/Qualifiers
FT   CDS_pept        170559..171494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0173"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0078 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48609"
FT                   /db_xref="GOA:D3F531"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F531"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48609.1"
FT                   /translation="MSAVAMRERAASGRRRRSARRRPLRQFLIYVGVALFAIWVLFPLY
FT                   FTVTSSFMKPSEVGRVPYHWVPEEPTLKNYTAILKGDSTPFSDDAARGVSVSSTNAVER
FT                   LMPAMGRSVMVGLVVVFINLVVGGAAAYAFSRYPFRGAKIAYLGLLASRVVPAIAIVSP
FT                   FFVFFRKTELLNTAPALIISYLVFTLPLAIWLLKSYFDSVPKELEEAAMLDGASRLKCL
FT                   ISIVLPLARPGLIAAGLLVFLEAWSEFFYALVLTNELTAPPVVAGLQNLQQFSWTTLAA
FT                   ASIFSLIPPVLIAVVFQRYIVSGLARGSVR"
     atgagcgccg tcgcgatgag agagcgggcc gcgagcgggc gcagacgccg cagcgcgaga        60
     cggcgcccgc tgcgccagtt cttgatctac gtcggcgtcg cgctgttcgc gatctgggtc       120
     ctgttcccgc tgtacttcac cgtcaccagc agcttcatga agccctccga ggtcggcaga       180
     gtgccgtatc actgggtgcc cgaggagccg acgctgaaga actacacggc gatcctcaag       240
     ggcgactcga cgccgttcag cgacgacgcc gccagaggcg tcagcgtctc cagcacgaac       300
     gccgtcgagc ggctgatgcc ggcgatgggg cggagcgtga tggtcggcct cgtcgtcgtc       360
     ttcatcaacc tcgtcgttgg aggtgcggcg gcgtacgcct tctcccgcta tccgttccgc       420
     ggggcgaaga tcgcctatct cgggctgctc gcctcgcggg tggtgcccgc gatcgcgatc       480
     gtctcgccgt tcttcgtctt cttccgcaag acggagctgc tgaacaccgc tccggcgctg       540
     atcatcagct acctcgtctt cacgctgccg ttggcgatct ggctgttgaa gtcgtacttc       600
     gacagcgtgc cgaaggagct ggaggaggcg gcgatgctcg acggcgcctc gcgcctgaag       660
     tgcctgatct cgatcgtcct gccgctcgcg cggccggggc tgatcgcggc cgggctgctc       720
     gtcttcctcg aagcgtggag cgagttcttc tacgcgctcg tgctgacgaa cgagctgacc       780
     gctccgccgg tcgtcgcagg gctgcagaac ctgcagcagt tctcatggac cacgctggcc       840
     gccgcgtcga tcttcagcct catcccaccg gtgctgatcg ccgtcgtctt ccagcgctac       900
     atcgtcagcg ggctcgcccg cgggagcgtt cgatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page