(data stored in ACNUC7421 zone)

EMBL: CP001854.PE174

CP001854.PE174       Location/Qualifiers
FT   CDS_pept        171491..172438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0174"
FT                   /product="aryldialkylphosphatase"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: kpu:KP1_2777
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48610"
FT                   /db_xref="GOA:D3F532"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3F532"
FT                   /inference="protein motif:PFAM:PF02126"
FT                   /protein_id="ADB48610.1"
FT                   /translation="MNSSERVMTVLGPIAPEQMGVTLSHDHLLVDGWGIRELYDAILDD
FT                   EELAVREAARYKAAGGGTICDPTNIGLARAPAALKRISERSGVHVVMGAGWYRERVYPD
FT                   YVLEEMPDQLADRLVTELVDGVDGTGVKPGFIGEIGTERHHVTPAQERVFRAAGRAHRR
FT                   TGVPIMTHTTHWGELAIEQLDLLAEEGVPAAAVIISHLGDRPGIRHWLPIAERGAWLDV
FT                   DNLAFIGGYAPLSVRADNVAGLCAEGLAGQVMLSNDICELGQLAFYDGCGYDNVIVNFL
FT                   PMLRERGVSEEDIHTMTVANPGKAFAWDLSRVGA"
     atgaacagca gtgaacgggt catgaccgtg ctcgggccga tcgcgcccga gcagatgggc        60
     gtgacgctca gccacgacca cctgctcgtc gacgggtggg ggatccgcga gctgtacgac       120
     gcgatcctcg acgacgagga gctggccgtc agagaggcgg cgcgctacaa ggcggccggc       180
     ggcgggacga tctgcgaccc gaccaacatc gggcttgcgc gcgctccggc ggccctgaag       240
     cggatcagcg agcgcagcgg cgtccacgtc gtgatgggcg ccggctggta ccgcgagcgc       300
     gtctacccgg actacgtgct ggaggagatg cccgaccagc tcgccgaccg gctcgtcacc       360
     gagctggtcg acggggtcga cgggaccggc gtcaagcccg gcttcatcgg cgagatcgga       420
     accgagcgcc accacgtgac gccggcgcag gagcgcgtct tccgtgccgc cggccgtgcg       480
     caccgccgca ccggcgtgcc gatcatgacg cacacgacgc actggggcga gctggcgatc       540
     gagcagctcg acctgctcgc cgaggagggg gttccggccg ccgcggtgat catctcccac       600
     ctcggcgacc ggcccggcat ccgccactgg ctgccgatcg ccgagcgcgg cgcctggctc       660
     gacgtcgaca acctcgcctt catcggcggc tacgcgccgc tgtcggtccg cgccgacaac       720
     gtcgcggggc tgtgcgcgga agggctcgcc ggccaggtca tgctgtcgaa cgacatctgc       780
     gagctgggcc agctcgcctt ctacgacggc tgcggctacg acaacgtgat cgtcaacttc       840
     ctgccgatgc tgcgcgagcg cggcgtcagc gaggaggaca tccacacgat gacggtcgcg       900
     aacccgggca aggcgttcgc gtgggacctc agccgggtcg gagcgtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page