(data stored in ACNUC7421 zone)

EMBL: CP001854.PE175

CP001854.PE175       Location/Qualifiers
FT   CDS_pept        172435..173670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0175"
FT                   /product="Pyridoxal phosphate-dependent transferase"
FT                   /note="PFAM: Pyridoxal phosphate-dependent transferase;
FT                   aminotransferase class V; Cys/Met metabolism pyridoxal-
FT                   phosphate-dependent protein; KEGG: mlo:mlr3804
FT                   selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48611"
FT                   /db_xref="GOA:D3F533"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:D3F533"
FT                   /inference="protein motif:PFAM:PF03841"
FT                   /protein_id="ADB48611.1"
FT                   /translation="MTALLDSLGVRPLINAVGPATRLGSSTPSADVLAAMAEAAAVYLP
FT                   MHELQRAAGAEIAALTGAEAGYVTNGAAAGLMLAAAACIAGDDPALMNRLPFTDGMRDE
FT                   IVVHRGQRIAYDHAVRASGARLVEIGFHDLTFPYELDAAIGERTAAVLYFSNSGANALP
FT                   LEQVVAIAHARGVPVILDASLAIPPVENLRRFADLGVDLVAVSGGKWIGGPAASGFLYG
FT                   RADLLRSVALQQQDQDVRVETWHGAPLIAGGTVAGPPHQGIGRALKVGKEEIAGLLAAL
FT                   RAYVARDHAADQARWRAAAQTVVDALAGIPGADARVLPADGRERGWPIAEIALDEPALG
FT                   LGAYDVVRALAAGAPPIALDEAVAWRGALRVTPTHLRDGEAAVVAAALAAALRRTDPTS
FT                   AHTKADRKDTDA"
     gtgaccgcgc tgctcgacag cctcggcgtg cgcccgctga tcaacgcggt cggcccggcg        60
     acgcggctcg gctcctcgac gccgtcggcg gacgtgctcg ccgcgatggc cgaggcggcc       120
     gccgtctacc tgccgatgca cgagctgcag cgcgccgccg gcgccgagat cgcggcgctg       180
     accggcgccg aggcgggcta cgtcaccaac ggcgcggcgg ccgggctgat gctcgccgcc       240
     gccgcctgca tcgcgggcga cgacccggcg ctgatgaacc ggctgccgtt caccgacggc       300
     atgcgcgacg agatcgtcgt ccaccgcggc cagcggatcg cctacgacca cgccgtgcgc       360
     gcgtcgggcg cgcggctggt cgagatcggc ttccacgacc tcaccttccc gtacgagctc       420
     gacgccgcga tcggcgagcg gaccgccgcc gtcctctact tctccaacag cggcgcgaac       480
     gcgcttccgc tggagcaggt cgtcgcgatc gcgcacgcgc gcggcgtgcc ggtgatcctc       540
     gacgcgtcgc tcgcgatccc gccggtcgag aacctgcgcc gcttcgccga cctcggcgtc       600
     gacctcgtcg ccgtcagcgg cgggaagtgg atcggcggcc cggccgcgtc gggcttcctc       660
     tacggccgcg ccgacctgct gcgctcggtc gcgctccagc agcaggacca ggacgtgcgc       720
     gtcgagacgt ggcacggcgc gccgctgatc gccggcggca ccgtcgccgg cccgccgcac       780
     cagggcatcg gccgcgcgct caaggtcggc aaggaggaga tcgccggcct gctcgccgcg       840
     ctgcgggcgt acgtcgcgcg cgaccacgcc gccgaccagg cgcgctggcg cgccgccgcg       900
     cagacggtgg tcgacgcgct cgccgggatc cccggcgccg acgcgcgcgt gctgccggcc       960
     gacggccgcg agcgcggctg gccgatcgcc gagatcgcgc tcgacgagcc ggcgctcggg      1020
     ctcggcgcct acgacgtcgt gcgtgcgctc gccgccggcg cgccgccgat cgcgcttgac      1080
     gaggcggtcg cctggcgcgg cgcgctgcgc gtcaccccga cgcacctgcg cgacggcgag      1140
     gcggccgtcg tcgcggccgc cctcgccgcg gcgctgcggc ggacggaccc gacttcagct      1200
     cacacgaagg cagacaggaa ggacacggac gcatga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page