(data stored in ACNUC7421 zone)

EMBL: CP001854.PE176

CP001854.PE176       Location/Qualifiers
FT   CDS_pept        173667..174425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0176"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: avn:Avin_21180 2,3-dihydro-2,3-
FT                   dihydroxybenzoate dehydrogenase, short-chain
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48612"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F534"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48612.1"
FT                   /translation="MTGTAVVVGGGRGIGRAIAVELARDEGVERLVVADVDLELAQETA
FT                   AAGSGDAECVARRVDLAEPASVQELFAASREATRVAIPGGVFSASPSLELEREEMERIL
FT                   RINLVGCYHAAQLYAGAMASSGGGAIVGIASIAARMPRMRQAAYSASKAGLRQALRVLA
FT                   MEVAGDGVRINTVSPGPTDTPMMRELASDHSSVDDLAQGSALALRPRIPVGRVATSEDI
FT                   AVATRFLLSPGAAHIVMQDLVVDGGELLGM"
     atgaccggga cggcggtagt ggtcggaggg gggcgtggca tcggccgcgc gatcgcggtc        60
     gagctggcgc gggacgaagg cgtcgagcga ctcgtcgtcg ccgacgtcga cctcgagctg       120
     gcgcaggaga cggcggccgc aggctccggt gacgccgagt gcgtcgcccg ccgggtcgac       180
     ctcgctgagc cggcgtcggt gcaggagctg ttcgcggcca gccgcgaggc gacgcgcgtc       240
     gcgatccccg gcggcgtctt cagcgcgtcg ccgtcgctgg agctggagcg cgaggagatg       300
     gagcggatcc tgcggatcaa cctcgtcggc tgctaccacg cggcgcagct ctacgcgggc       360
     gcgatggcgt cgagcggcgg cggcgcgatc gtcggcatcg cctcgatcgc ggcgcggatg       420
     ccgcggatgc ggcaggcggc gtactcggcc tcgaaggcgg gcctccggca ggcgctgcgc       480
     gtgctggcga tggaggtcgc cggcgacggc gtgcggatca acaccgtctc gcccggcccg       540
     accgacacgc cgatgatgcg tgagctggcg agcgaccact cgtcggtcga cgacctcgcg       600
     cagggcagcg cgctcgcact ccggccgcgg atcccggtcg gccgcgtcgc gaccagcgag       660
     gacatcgccg tcgcgacccg cttcctgctc tcgcccgggg ccgcccacat cgtgatgcag       720
     gacctcgtcg tcgacggcgg cgagctgctg gggatgtag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page