(data stored in ACNUC7421 zone)

EMBL: CP001854.PE177

CP001854.PE177       Location/Qualifiers
FT   CDS_pept        174428..175579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0177"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: mlo:mll4451
FT                   dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48613"
FT                   /db_xref="GOA:D3F535"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3F535"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADB48613.1"
FT                   /translation="MDALLLHGGTVVDPEARGETRRRADVLVVDGRIAAVEEAPICPDG
FT                   VETVDVSGLLVTPGLVDLHAHVFVGQDLGVDPDVVGPASGTTTFVDTGSAGGHLFGAFR
FT                   RGTIDRATARVRAFLNISSIGATSILLAGELENLAYCDEEVAAICATEHADLVIGIKVR
FT                   ASGNVVGASGAEPMLRARRVADRLGLPLMIHLGPAPPGSDEIMAQLHAGDVLTHCFTGF
FT                   EDNRLFLDGRVRESVLAARERGVVFDVAHGMSAFDAEVATEMLAAGFLPDTISSDVHAY
FT                   SLDAIGDLPAVMSKFLALGMDVDDVIARTTLKPAQHAGLAADGVGTLRIGAPADVAAFE
FT                   LVEGPIAYADTRGGTFSGSRRLRAALTVRAGAIVHDARKERQP"
     gtggacgctc tgctcctgca cggcggcacg gtcgtcgacc cggaggcccg cggcgagacg        60
     cgccgccgcg ccgacgtgct cgtcgtcgac gggcgcatcg ccgccgtcga ggaggcgccg       120
     atctgcccgg acggcgtcga gacggtcgac gtctccggcc tgctcgtgac gcccggtctc       180
     gtcgacctgc acgcgcacgt cttcgtcggg caggacctcg gcgtcgaccc cgacgtcgtc       240
     ggccccgcct ccggcacgac gacgttcgtc gacaccggca gcgccggcgg ccacctgttc       300
     ggcgcgttcc ggcgcggcac gatcgaccgc gcgacggcgc gcgtgcgcgc gttcctcaac       360
     atctcctcga tcggcgcgac gtcgatcctg ctcgcgggcg agctggagaa cctcgcctac       420
     tgcgacgagg aggtcgcggc gatctgcgcg acggagcacg ccgacctcgt gatcgggatc       480
     aaggtgcgcg cgtcgggcaa cgtcgtcggg gccagcggcg cggagccgat gctgcgcgcg       540
     cgccgcgtcg ccgaccggct cggcctgccg ctgatgatcc acctcggccc ggcgccgccc       600
     gggagcgacg agatcatggc ccagctgcac gcgggcgacg tgctgacgca ctgcttcacc       660
     ggcttcgagg acaaccgcct cttcctcgac ggccgcgtgc gcgagtcggt tctcgccgcg       720
     cgcgagcgcg gcgtcgtctt cgacgtggcg cacgggatgt cggcgttcga cgcggaggtc       780
     gcgaccgaga tgctcgccgc cggcttcctg cccgacacga tcagcagcga cgtgcacgcc       840
     tactcgctcg acgcgatcgg cgacctgccg gcggtgatgt cgaagttcct cgcgctcggg       900
     atggacgtcg acgacgtgat cgcccgcacg acgctgaagc cggcgcagca cgcggggctc       960
     gccgctgacg gcgtcggtac gctccgcatc ggggcacccg ccgacgtcgc cgcgttcgag      1020
     ctggtcgaag gtccgatcgc gtacgcggac acccgcgggg ggacgttctc gggaagccgc      1080
     cggctgcgag cggcgctgac cgtgcgcgcc ggagccatcg tccacgacgc tcggaaggaa      1140
     cgccagccat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page