(data stored in ACNUC7421 zone)

EMBL: CP001854.PE178

CP001854.PE178       Location/Qualifiers
FT   CDS_pept        175576..176421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0178"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   vvy:VV0550 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48614"
FT                   /db_xref="GOA:D3F536"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F536"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADB48614.1"
FT                   /translation="MKNGGTAEEAAFTTVKSADRVLVVLELLAGREPMRLMDIADELEM
FT                   PRSSTSNLLRTMARRRFVEYDEGDKRYRIGSRMRELARASEREGDLVSLAQPLMDRLVE
FT                   QTGETVQLAQLEAMEVVYLAISESPHPMKLVSEVGKRLFAHGTGVGKTLLAQLDLADAE
FT                   QRLRSVELPRFTPATIIDVDDLLDGLREIGERGYGTDDEEYVLGCRCIAMPVHGPRGDT
FT                   IAAMSVSIPTPRYDDEVGERALEALRSATAELSRQLGWVETASGAAVGAVGTSGAGEPA
FT                   "
     atgaagaacg ggggaacggc tgaggaggcc gccttcacga ccgtcaagtc cgcggaccgc        60
     gtgctggtcg tgctggagct gctggcgggg cgtgagccga tgcggctgat ggacatcgcg       120
     gacgagctgg agatgccgcg ctcgtccacc tccaacctgc tgcggacgat ggcccgccgt       180
     cgcttcgtcg agtacgacga gggcgacaag cgctaccgga tcggctcgcg gatgcgggag       240
     ctggcgcgcg ccagcgagcg cgagggcgac ctcgtctcgc ttgcgcagcc gctgatggac       300
     cggctcgtcg agcagaccgg cgagacggtg cagctcgcac agctggaggc gatggaggtc       360
     gtgtacctcg cgatcagcga gtcgccgcac ccgatgaagc tcgtctccga ggtcggcaag       420
     cggctgttcg cgcacggcac cggcgtcggc aagacgctgc tcgcgcagct cgacctcgcc       480
     gacgcggagc agcggctgcg ctcggtcgag ctgccccgct tcacgcccgc gacgatcatc       540
     gacgtcgacg acctgctcga cggcctgcgc gagatcggcg agcgcggcta cgggaccgac       600
     gatgaggagt acgtgctcgg ctgtcgttgc atcgcgatgc cggtgcacgg cccgcgcggc       660
     gacacgatcg ccgcgatgtc ggtctcgata ccgacgccgc gctacgacga cgaggtcggc       720
     gagcgggcgc tggaggcgct gcgcagcgcg accgccgagc tgtcgcgcca gctcgggtgg       780
     gtcgagacgg cgtccggcgc tgcggtcggc gcggtcggca cgtccggcgc gggggagccc       840
     gcgtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page