(data stored in ACNUC7421 zone)

EMBL: CP001854.PE179

CP001854.PE179       Location/Qualifiers
FT   CDS_pept        176418..177536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0179"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   sme:SM_b21134 putative amino acid processing enzyme, low
FT                   specificity D-threonine aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48615"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:D3F537"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADB48615.1"
FT                   /translation="MTLDAVDTPALVVDRDVLRANVEAMAALARDAGVALRPHAKTHKL
FT                   PQVARMQLDAGAAGLTVAKLGEAEVFADAGVTDLLIAYPLVGELKLARLVALARRLASE
FT                   PGGCIAVAVDAVETATGISDAVAAAGVEVGVRVEVDTGMHRLGLEPASAALVELARAVA
FT                   ALPGLRFEGVMTHEGQAYQAASEAELERAAADACEAMVASAAAIRAAGVDCPVVSMGST
FT                   ATARFAAGHPGVTEIRPGTYVFNDRSQVAHGSATAGDLAATVLATVVSRPSAGVACVDA
FT                   GAKALTSDRMIVPGADGDFGAVAPSGWPVARASEEHGLVALPAGADVAVGTRVAIAPNH
FT                   ICPVVNLFDAVTVVERGHVVDRWPVAARGRMT"
     gtgacgcttg acgcggtcga cacgccggcg ctggtcgtcg accgcgacgt gctgcgcgcg        60
     aacgtcgagg cgatggccgc gctcgcgcgc gacgccggcg tcgcgctgcg accgcacgcc       120
     aagacgcaca agctgccgca ggtcgcgcgg atgcagctcg acgccggcgc cgccggcctg       180
     acggtcgcca agctcggcga ggccgaggtc ttcgcggacg ccggcgtgac cgatctgctg       240
     atcgcctatc cgctcgtcgg cgagctgaag ctcgcgcgcc tcgtcgcgct ggcgcggcgg       300
     ctcgcctcgg agcccggcgg ctgcatcgcg gtcgcggtcg acgctgtgga gaccgcgacg       360
     gggatctcgg atgcggtcgc cgcagccggc gtcgaggtcg gcgtgcgcgt ggaggtcgac       420
     accggcatgc accggctcgg cctcgaaccg gcgtccgcgg cgctggtcga gctggcgcga       480
     gcggtcgcgg cgctgcccgg cctgcgcttc gagggcgtga tgacgcacga ggggcaggcc       540
     taccaggccg cctcggaggc ggagctggag cgcgccgccg ccgacgcctg cgaggcgatg       600
     gtcgcgagcg ccgcggcgat ccgcgcggcc ggcgtcgact gccccgtcgt ctcgatgggg       660
     tcgaccgcga ccgcacgctt cgccgccggc catcccggcg tcaccgagat ccgccccggc       720
     acctacgtct tcaacgaccg cagccaggtc gcgcacggca gcgcgacggc cggagatctc       780
     gccgcgaccg tgctggcgac ggtcgtcagc cgcccctcgg ctggcgtcgc gtgcgtcgac       840
     gcgggcgcga aggcgctgac gtcggaccgc atgatcgtgc ccggcgccga cggcgacttc       900
     ggcgccgtcg ccccgagcgg ctggccggtc gcgcgcgcga gcgaggagca cggcctcgtc       960
     gcgctgccgg ccggcgccga cgtcgccgtc gggacgcgcg tcgcgatcgc gccgaaccac      1020
     atctgccccg tcgtgaacct gttcgacgcc gtcaccgtcg tcgagcgggg ccacgtcgtc      1080
     gaccgttggc ccgtggctgc ccgcgggcgc atgacatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page