(data stored in ACNUC7421 zone)

EMBL: CP001854.PE18

CP001854.PE18        Location/Qualifiers
FT   CDS_pept        complement(22511..24019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0018"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: scl:sce0022 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48454"
FT                   /db_xref="GOA:D3EYQ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48454.1"
FT                   /translation="MSTLLGTLLNDRYRLEARIGTGGMSTVYRALDTTLERPVAIKLMN
FT                   REIASDSDQLERFRREARAVAQLSHPHIVGVIDAGEDAGRPYIVFEYVEGETLKERIRR
FT                   LGQLPIGEAVAYAIEIARALGAAHARHIVHRDVKPQNVLIDEEGSAKVTDFGIARTLDE
FT                   DGLTQDGRVLGTTDYVSPEQALGHPVGGQSDLYSLGIVLWEMLTGSVPFRGENQVAVAM
FT                   KHVREEIPDVRELRPEVSASLASVIDRATAKDLLERYRSDEELIADLEDVLALETARAG
FT                   SATGEATTVIRTLPRSAQRRLPLSVRRPAWLAVLALLVVAALVAAIVFALENGERGTGR
FT                   SAGRARDGPVQLQQISLAQTAASDYDPTSSGGDGEEHSEETTFAVDNNPSTFWSTERYE
FT                   NAVLPKDGVGLAVDVSPGAVLRKMRVRTNTPGFSADVYVTDAADVPESLDDPAWRRVAT
FT                   SSDVQRRQDIDLDTAGQRSRHVLLWITRLPSGGKVEISEIALFR"
     atgagcaccc tgctcggaac cctcctcaac gaccgctatc gactcgaggc ccggatcggg        60
     accggcggga tgtcgacggt ctaccgcgcg ctcgacacga cgctggagcg gccggtcgcg       120
     atcaagctga tgaaccgcga gatcgcgtcg gactccgacc agctcgagcg cttccggcgc       180
     gaggcgcgcg cggtcgcgca gctctcccac ccccacatcg tcggcgtgat cgacgcgggc       240
     gaggacgccg gccgcccgta catcgtcttc gagtacgtcg agggcgagac gctgaaggag       300
     cggatccgcc ggctcggcca actcccgatc ggcgaggcgg tcgcgtacgc gatcgagatc       360
     gcgcgggcgc tcggcgccgc gcacgcccgg cacatcgtcc accgcgacgt gaagccccag       420
     aacgtgctga tcgacgagga gggcagcgcg aaggtcaccg acttcgggat cgcgcgcacg       480
     ctcgacgagg acgggctgac gcaggacggc cgcgtgctcg gcacgaccga ctacgtctct       540
     cccgagcaag cgctcggcca ccccgtcggc ggccagtccg acctctactc gctcggcatc       600
     gtgctgtggg agatgctgac gggcagcgtc ccgttcagag gcgagaacca ggtcgccgtc       660
     gcgatgaagc acgtgcgcga ggagatcccc gacgtacgcg agctgcggcc ggaggtgtcg       720
     gcgtcgctgg cgtcggtgat cgaccgcgcg accgcgaagg acctgctgga gcgctaccgc       780
     agcgacgagg agctgatcgc cgacctcgag gacgtgctcg cgctcgagac ggcgcgcgcc       840
     ggcagcgcga ccggcgaggc gacgaccgtg atccgcacgc tgccgcgcag cgcccagcgc       900
     aggctgccgc tgagcgtccg ccggccggcc tggctcgccg tcctcgcgct gctcgtcgtc       960
     gcggcgctcg tcgccgcgat cgtgttcgcg ctcgagaacg gcgagagagg gaccggcaga      1020
     tccgccggca gagcgagaga cggtcccgtc cagctgcagc agatcagcct ggcgcagacg      1080
     gccgcctccg actacgaccc gaccagcagc ggcggcgacg gcgaggagca ctccgaggag      1140
     acgaccttcg ccgtcgacaa caacccgtcg acgttctgga gcaccgagag atacgagaac      1200
     gccgtcctgc cgaaggacgg cgtcggcctc gcggtcgacg tctctcccgg cgcggtgctg      1260
     cgcaagatgc gcgtccgcac gaacaccccc ggcttctccg ccgacgtcta cgtgaccgac      1320
     gccgccgacg tgcccgagag cctcgacgat cccgcgtggc gcagagtcgc gaccagctcc      1380
     gacgtccagc gcagacagga catcgacctc gacacggccg ggcagcgcag ccgccacgtg      1440
     ctgctgtgga tcacgagact gccctccggc ggcaaggtcg agatcagcga gatcgcgctg      1500
     ttcaggtag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page