(data stored in ACNUC7421 zone)

EMBL: CP001854.PE180

CP001854.PE180       Location/Qualifiers
FT   CDS_pept        177562..178743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rlg:Rleg_5221 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48616"
FT                   /db_xref="GOA:D3F538"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D3F538"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48616.1"
FT                   /translation="MAAIRLTDVCKEYDGSGALAVDGVDLEIADGEFMVLVGPSGCGKS
FT                   TLLRMIAGLEDVTFGTIEIGERDVTDEEPRDRDVAMVFQNYALYPHLSVRENIGFGLKL
FT                   RKMAKAEMNERVERVARSLGLTEYLDRKPAQLSGGQRQRVAMGRAMVRQPAAYLMDEPL
FT                   SNLDAKLRVAMRAELARLHEQLGVTTVYVTHDQVEAMTLGSRVAVLRGGVLQQCDTPET
FT                   LFERPANAFVAGFIGSPAMNLLEGTVAGDVVRFGAESLALAPEVGERVGERDVILGIRP
FT                   TDFLLAGPDVDPALPRLRVVPDVVERLGSEIHIIFGIEATQLDLDGRGGLTGERDAQLL
FT                   GDTRALLTARLEAGAPVAVGQPVELAVRRERIHFFTRDDGLRIETADPALTTA"
     atggccgcga tcaggctgac cgacgtttgc aaggagtacg acggcagcgg tgcgctcgcg        60
     gtcgacggcg tcgacctgga gatcgccgac ggcgagttca tggtgctcgt cggcccgtcc       120
     ggctgcggca agtcgacgct gctgcggatg atcgcggggc tggaggacgt caccttcggc       180
     acgatcgaga tcggcgagcg cgacgtgacc gacgaggagc cgcgcgaccg cgacgtcgcg       240
     atggtgttcc agaactacgc gctctacccg cacctgtcgg tgcgcgagaa catcggcttc       300
     gggctgaagc tgcgcaagat ggcgaaggcg gagatgaacg agcgggtcga gcgcgtcgcg       360
     cgctcgctcg ggctgacgga gtacctcgac cgcaagccgg cgcagctctc cggcggtcag       420
     cgccagcgcg tcgcgatggg ccgcgcgatg gtgcgtcagc cggccgcgta cctgatggac       480
     gagccgctct ccaacctcga cgcgaagctg cgcgtcgcga tgcgggcgga gctggcacgg       540
     ctgcacgagc agctgggggt cacgaccgtg tacgtgacgc acgaccaggt cgaggcgatg       600
     acgctcggct cgcgcgtcgc ggtgctgcgc ggcggcgtgc tgcagcagtg cgacacaccc       660
     gagacgctgt tcgagcggcc cgcgaacgcg ttcgtcgcgg gcttcatcgg ctcaccggcg       720
     atgaacctgc tggaggggac ggtcgccggc gacgtcgtgc gcttcggcgc cgagtcgctg       780
     gcgctcgcgc cggaggtcgg cgagcgcgtc ggcgagcgcg acgtgatcct cggcatccgc       840
     ccgaccgact tcctgctcgc ggggcccgac gtcgatccgg cgctgccgcg gctgcgcgtc       900
     gtgccggacg tcgtcgagcg gctcggctcg gagatccaca tcatcttcgg gatcgaggcg       960
     acccagctcg acctcgacgg ccgcggcggc ctcaccggcg agcgcgacgc gcagctgctc      1020
     ggcgacacgc gcgcgctgct gaccgcgcgg ttggaggccg gcgcccccgt cgccgtcggc      1080
     cagccggtcg agctggcggt ccgccgcgag cggatccact tcttcacccg cgacgacggc      1140
     ctgcggatcg agaccgccga cccggcgctc acgaccgcct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page