(data stored in ACNUC7421 zone)

EMBL: CP001854.PE181

CP001854.PE181       Location/Qualifiers
FT   CDS_pept        complement(178809..179231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0181"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48617"
FT                   /db_xref="GOA:D3F539"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F539"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADB48617.1"
FT                   /translation="MSVLLLDASVWIASVDGDDRHHAAARELIADGPGARELAALDLTV
FT                   FEVANVAVRSWRDVARATRLAELVEVSCASDLERIDGETAAYTVRIADELGLTAYDAAY
FT                   VAVSRRRGWTLVSCDMKDLVGPGHAVAPDDVPPLAS"
     gtgagcgtcc tgctgctcga cgcaagcgtc tggatcgcgt cggtcgacgg tgatgacaga        60
     caccatgccg ccgcacgcga gctgatcgcg gacgggccgg gcgcgcgcga gctggcggcg       120
     ctcgatctga ccgtgttcga ggtcgcgaac gtggcggtcc gcagctggcg cgacgtcgcc       180
     cgcgcgacgc gtctcgccga gctggtcgag gtctcatgcg cgtcggacct cgagcggatc       240
     gacggcgaga cggcggcgta caccgtccgc atcgccgacg agctggggtt gaccgcgtac       300
     gacgcggcct acgtggcggt ctcgcggcgg cgcggctgga cgctcgtcag ctgcgacatg       360
     aaggacctcg tcggaccggg gcacgccgtc gcaccggacg acgtgccgcc gctcgcgagc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page