(data stored in ACNUC7421 zone)

EMBL: CP001854.PE183

CP001854.PE183       Location/Qualifiers
FT   CDS_pept        complement(179501..180925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0183"
FT                   /product="sugar transporter"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1; KEGG:
FT                   cbd:CBUD_1731 D-xylose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48619"
FT                   /db_xref="GOA:D3F541"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F541"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ADB48619.1"
FT                   /translation="MAEAAASGSGHESHYRRNVWVTAGVAAMGGALFGYDTGMISGAQV
FT                   FIEQDFDVSSSGIGLVVSAVTAGALLGALATGPLTQRMSRRAIILLAAVVFIFGAALAA
FT                   AAPNVEVLIGARLVIGLAVGFASTVVPLYISEVVPTARRGSMVAMFQLAITAGILLAYL
FT                   VNAVFAGSEEWRAVFALAAVPATALFIGMLLLPNSPRWLVAVGRVDDAREVMQHVRDPD
FT                   DPATEQELQEIVAAVDEDARRAKQPLAQALTSPLARTILTVGIGLGIFQQITGINTIIY
FT                   YAPTILKEAGLGTETAALTTVGIGALNFLATLFALTVVDRIGRRTILIVGMTGMVLTMA
FT                   ALSIVFAIDDFDGIGQIVAVASLFGFIACFAISWGWGFWVMASEIYPLFIRGQAISIGN
FT                   TIQWGANFVISLLFPILLASWGGAPVFAMLAAFGIAALLFTWRLVPETNGKTLEEIEAE
FT                   WRRRAGVRDEPAAAPA"
     atggcggagg cggctgcgtc ggggtcgggg cacgagtccc actaccggcg gaacgtgtgg        60
     gtgacggccg gcgtcgccgc gatgggcggg gcgttgttcg gctacgacac cggcatgatc       120
     tccggcgccc aggtcttcat cgagcaggac ttcgacgtct cctcgtcggg gatcgggctc       180
     gtcgtcagcg ccgtgacggc gggcgcgctg ctcggcgcgc tcgcgaccgg tccgctgacg       240
     cagcggatgt cgcggcgggc gatcatcctg ctggcggccg tcgtcttcat cttcggcgcc       300
     gcgctcgccg cggcggcgcc gaacgtcgag gtgctgatcg gcgcgcgcct ggtcatcggc       360
     ctcgcggtcg ggttcgcctc gacggtcgtc ccgctctaca tctccgaggt cgtgccgacc       420
     gcgagacgcg ggtcgatggt ggcgatgttc cagctcgcga tcactgccgg catcctgctc       480
     gcctacctcg tcaacgccgt cttcgcgggc tcggaggagt ggcgcgccgt cttcgcgctc       540
     gcggcggtcc ccgcgacggc gctgttcatc ggcatgctgc tgctgcccaa cagcccgcgc       600
     tggctcgtcg cggtcggccg cgtggacgac gcgcgcgagg tgatgcagca cgttcgcgac       660
     cccgacgacc cggcgaccga gcaggagctg caggagatcg tcgccgcggt cgacgaggac       720
     gccagacgcg cgaagcagcc gctcgcgcag gcgctcacca gcccgctcgc gcggacgatc       780
     ctgaccgtcg ggatcgggct cgggatcttc cagcagatca ccggcatcaa cacgatcatc       840
     tactacgcgc cgacgatcct gaaggaggcc gggctcggca ccgagaccgc cgcgttgacg       900
     acggtcggga tcggcgcgct caacttcctc gcgacgctgt tcgcgctgac cgtcgtcgac       960
     agaatcggcc gccgcacgat cctgatcgtc ggcatgaccg gcatggtgct gacgatggcg      1020
     gcgctgtcga tcgtcttcgc gatcgacgac ttcgacggga tcggccagat cgtcgccgtc      1080
     gcctcgctgt tcggcttcat cgcctgcttc gcgatcagct ggggctgggg cttctgggtg      1140
     atggcgtcgg agatctaccc gctcttcatc cgcggccagg cgatctcgat cggcaacacg      1200
     atccaatggg gggcgaactt cgtcatctcg ctgctgttcc cgatcctgct cgcctcgtgg      1260
     ggcggcgcgc ccgtcttcgc gatgctggct gccttcggca tcgccgcgct gctgttcacg      1320
     tggcggctcg tgcccgagac gaacggcaag acgctggagg agatcgaggc ggagtggcgc      1380
     cgccgcgccg gcgtcagaga cgagccggcg gcagcgcccg cctga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page