(data stored in ACNUC7421 zone)

EMBL: CP001854.PE184

CP001854.PE184       Location/Qualifiers
FT   CDS_pept        181066..182772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0184"
FT                   /product="X-Pro dipeptidyl-peptidase domain protein"
FT                   /note="PFAM: X-Pro dipeptidyl-peptidase domain protein;
FT                   peptidase S15; KEGG: pat:Patl_0930 X-Pro
FT                   dipeptidyl-peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48620"
FT                   /db_xref="GOA:D3F542"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F542"
FT                   /inference="protein motif:PFAM:PF08530"
FT                   /protein_id="ADB48620.1"
FT                   /translation="MTLLSEIAGRSLRLPRAQTRDVVVERDLPATMDDGVVLLADRYIA
FT                   RAEPSDGTDSPPPTVLIRTPYGRRGFFGFVYGRLLAERGFQTVVQSVRGTFGSGGEFTP
FT                   FDERADGLATLRWLRDQPWCEGPVGMIGSSYMGLTQWAVASAADGSIGALAPSITASQF
FT                   HGQAYGGGSISLDTALSWMLIIAAQERRLAPLRLILGMRRSLPRAFDALPLQEVDALVA
FT                   GEPVPFFREWFDVTAPDDPYWTQRDFSADVAGVTAPVQLIGGWQDIFLPWLIEDYVALR
FT                   RAGRTTQLVVGPWAHTSPGLLAASTREGIAWLRAHLAGDRRLLDEAPVRVWVGGENAWR
FT                   ALPDWPPPGVRPWRLHLRGGGRLAEAPPPDPTAVAVQPGGAADAAASDTAPDRFRYDPN
FT                   DPTPALGGPVLLAREPVTDNRPLEARADVLTFTTAPLEHDVEALGPVEADLHVRTSSPY
FT                   ADVFVRVCDVEPDGRSLNVCDALIRLTADAPPAAADGSRRVSFQLWPTAHRFGAGHRVR
FT                   VLVAGGAHPRYARNAGTGEPPQTATRLVAVDHELLHDAAHPSAVVLSVRGG"
     atgacccttc tgagcgagat cgcggggcgc tcgctgcgtc tgccgcgcgc gcagacgcgg        60
     gacgtcgtcg tcgagcgcga cctgccggcg acgatggacg acggcgtcgt cctgctggca       120
     gatcgttaca tcgcgcgcgc ggagccctcc gacggcaccg attcgccccc tccgacggtg       180
     ttgatccgca ccccgtacgg ccggcgcggc ttcttcggct tcgtctacgg gcggctgctc       240
     gccgagcgcg gcttccagac ggtcgtgcag agcgtgcgcg ggacgttcgg ctcgggcggc       300
     gagttcacgc cgttcgacga gcgcgccgat ggcctcgcga cgctgcgctg gctgagagac       360
     cagccgtggt gcgaggggcc ggtcgggatg atcggcagca gctacatggg cctcacgcag       420
     tgggcggtcg cgagcgcggc ggacggctcg atcggcgcgc tcgcgccgtc gatcaccgcc       480
     tcgcagttcc acggccaggc gtacggcggc ggctcgatct cgctcgacac cgcgctctcc       540
     tggatgctga tcatcgccgc gcaggagcgc cggctcgcgc cgctgcggct gatcctcggg       600
     atgcgccgca gcctcccccg cgcgttcgat gcgctcccgt tgcaagaggt cgacgcgctc       660
     gtcgccgggg agcccgtccc gttcttccgc gagtggttcg acgtcacggc accggacgac       720
     ccgtactgga cccaacgcga cttctccgcc gacgtcgccg gcgtcaccgc gccggtccag       780
     ctgatcggcg gctggcagga catcttcctg ccgtggctga tcgaggacta cgtcgcgctg       840
     cgcagagccg gccgcacgac ccagctcgtc gtcggtccgt gggcgcacac ctctccgggc       900
     ctgctcgccg ccagcacgcg cgaggggatc gcgtggctgc gggcgcatct ggccggcgac       960
     cgccgcctgc tcgacgaggc cccggtgcgc gtctgggtcg gcggtgagaa cgcctggcgc      1020
     gcgctgcccg actggccgcc gcccggcgtc cgcccctggc ggctgcacct gcgcggcggc      1080
     ggtcggctcg ccgaggcgcc gccgccggat cccacggctg tcgccgtcca gcccggcggc      1140
     gctgccgacg cggccgcgag cgacaccgca ccggaccgct tccgctacga ccccaacgac      1200
     ccgacgcccg cgctcggcgg ccctgtcctg ctcgcgcgcg agccggtgac ggacaaccgc      1260
     ccgctcgaag cgcgcgccga cgtcctcacc ttcacgacgg cgccgctgga gcacgacgtc      1320
     gaggcgctcg ggccggtcga ggccgacctg cacgtgcgca cgagcagccc ctacgccgac      1380
     gtcttcgtgc gcgtctgcga cgtcgagccc gacgggcgct cgctcaacgt ctgcgacgcg      1440
     ctgatccgcc tcaccgccga cgcgccgccc gcggcggccg acggcagccg ccgcgtcagc      1500
     ttccagctgt ggccgaccgc gcaccgcttc ggagccggcc accgcgtccg cgtgctcgtc      1560
     gcgggcggcg cccacccgcg ctacgcgcgc aacgccggca ccggcgagcc gccgcagacc      1620
     gcgacgaggc tcgtcgcggt cgaccacgag ctgctgcacg acgccgcgca cccgtcggcg      1680
     gtcgtgctga gcgtgcgcgg cggctga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page