(data stored in ACNUC7421 zone)

EMBL: CP001854.PE185

CP001854.PE185       Location/Qualifiers
FT   CDS_pept        complement(182806..184461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0185"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: sde:Sde_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48621"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F543"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADB48621.1"
FT                   /translation="MASRHSVARWLTACAATIALLAVLVPGAQAQNGDAGRPPALAWGD
FT                   CSAIEGANPRAECATATVPKDYGHRSRGTLDLYVARLPAKRPESRIGSLFVNFGGPGGT
FT                   AADRIATEPDTTEEGATFAALNERFDIVGVDPRGVGLSRPSIDCRANQETQGVYAQPFE
FT                   RPEILDPRAMVGRDVDYIAQCVRLNRDVLPYVSTANFARDLDGLRAAVGDDKMTYLGFS
FT                   YGTFLGATYESMFPRNTRAIVLDGALDPDQYVNDPLASLDEQSAGFERAVGRFLQACAR
FT                   DQAACAGFGGDDPWDALERLIEQAYASPIPAGDRPAIDGDDVNAAVVQAVYAKQLWPFL
FT                   ARALAALERGDGSRLRQLVDIFYGDNGDGTYDPITDRYFTIGALEQRYPHDLRTFLREG
FT                   RRSYQRYDHAWWNHGYVEAAWGFYPVEPRGVFRGPFVNPAGAPPTLVVGTTYDPATPYK
FT                   EARRLVGQLGNARLLTMRGDGHTAYGGNSPCIDAAVDAYLIDGTLPAEGTSCRQEVPFA
FT                   QPQPAAPAPLSAVADRQQDGPAIAVAPHVKPDFR"
     atggcttcac gccattcggt ggcgcgctgg ctgacggcct gcgccgccac gatcgcgctg        60
     ctcgccgtgc tggtgccggg cgcgcaggcg cagaacgggg acgccggccg gccgccggcg       120
     ctcgcatggg gcgactgctc cgcgatcgag ggcgccaacc cgcgcgccga gtgcgcgacc       180
     gcgacggtgc cgaaggacta cggccatcgc tcgcgcggca cgctcgacct gtacgtcgcg       240
     agactgccgg cgaagagacc ggagtcgcgc atcggctcgc tgttcgtgaa cttcggcgga       300
     cccggcggca cggccgccga ccgcatcgcg accgagcccg acacgaccga ggaaggagcg       360
     acgttcgcgg cgctcaacga gcgcttcgac atcgtcggcg tcgacccgcg cggcgtcggc       420
     ctcagcagac cgtcgatcga ctgcagagcg aaccaggaga cgcagggggt ctacgcgcag       480
     ccgttcgagc ggcccgagat cctcgacccg cgtgccatgg tcgggcgcga cgtcgactac       540
     atcgcgcagt gcgtgcgact gaaccgcgac gtgctgccgt acgtctcgac cgcgaacttc       600
     gcgcgcgacc tcgacgggct gcgcgcggcc gtcggcgacg acaagatgac gtacctcggc       660
     ttctcctacg ggacgttcct gggggcgacg tacgagtcga tgttcccgcg caatacgcgc       720
     gcgatcgtgc tcgacggcgc gctcgacccc gaccagtacg tcaacgaccc gctcgcctcg       780
     ctcgacgagc agtcggccgg cttcgagcgc gcggtcggac gcttcctgca agcctgcgcc       840
     cgcgatcagg ccgcctgcgc cggcttcggc ggcgacgacc cgtgggatgc gctggagcgg       900
     ctgatcgagc aggcgtacgc gtcgccgatc ccggccggtg accggccggc gatcgacggc       960
     gacgacgtca acgcggcggt cgtgcaggcg gtctacgcga agcagctgtg gccgttcctg      1020
     gcgcgcgcgc tcgcggcgct ggagagaggc gacggcagca gactgcgcca gctcgtcgac      1080
     atcttctacg gcgacaacgg cgacggcacg tacgacccga tcaccgaccg ctacttcacg      1140
     atcggcgcgc tcgagcagcg ctatccgcac gacctgcgca cgttcctgcg cgagggcaga      1200
     cgttcctacc agcgctacga ccacgcctgg tggaaccacg gctacgtcga ggcggcatgg      1260
     ggcttctacc ccgtcgagcc gcgcggcgtc ttccgcggcc cgttcgtgaa cccggccggc      1320
     gcgccgccga cgctcgtcgt cggcacgacg tacgacccgg cgacgccgta caaggaggcg      1380
     agacggctcg tcggacagct cggcaacgcg cgactgctga cgatgcgcgg cgacggccac      1440
     accgcctacg gcggcaactc gccgtgcatc gacgcggcgg tcgacgccta cctgatcgac      1500
     ggcacgctgc cggcggaggg gacgtcgtgc agacaggagg tcccgttcgc ccagccgcag      1560
     ccggccgcgc cggcgccgct gagcgcggtg gccgaccggc agcaggacgg tcccgcgatc      1620
     gcggtcgccc cgcacgtgaa gccggacttc cgctga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page