(data stored in ACNUC7421 zone)

EMBL: CP001854.PE186

CP001854.PE186       Location/Qualifiers
FT   CDS_pept        184675..186897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0186"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: lch:Lcho_3018 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold-3 domain protein; GGDEF domain containing
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48622"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3F544"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB48622.1"
FT                   /translation="MSSRPSFSAPFGERPREGKRDGRLVSRGLVVDAAPQQRARQALRA
FT                   AERLSRAVVDGLEEGVLVLDANLHPVSWNASVLRILGVTPEQLADVEQLAQAPATMSLR
FT                   YDSGKPVTPRDNPALRSLRHGAPVRATLHRETETGRERWITILARPIGGAHGTSRRGVV
FT                   CTFADVTSSVEAARRLREERDRAQHYLEVASTLVVVLDAGGRVELVNRQGCELLGYAEH
FT                   ELVGRDWNETVVPPGDRRDARAVFAQLLAGEQLPAERGETFLLTKAGEERKIAWRNAVV
FT                   RDATGTVASVLCSGEDVTERRRAEAQLAYLAHHDRLTGLPNRAPLEEQLQRDLARARRT
FT                   GGSVALVQVGLDNFKLVNDSLGHAAGDAVLSETAQRVAQLTRAGDVIARQGGDEFMLLL
FT                   DCGAEEAQVVAQLAGDRVMAALEQPFAVAGAEFHIGASIGIALFPGNANNAESLFKHAD
FT                   MAMHQAKRSGGGAVVFYERGAAEARERLSLTSRLRRAIDGDELRLHFQPIYRVEDGVLV
FT                   AVEALVRWEDPEHGLVPPAGFIPVAEETGLIEGIGSWVVEALCRQASRWAREGFRPRLC
FT                   FNLSPRQLRQPDLVDSIARTIARHELPPGQFCAELTETAVLSDERRHSSLLDELHEAGL
FT                   AIAIDDFGSGHSSLARLRDLPVQVLKVDRSFLRRVPEDPGSTAIVAAVLELGTALGMTT
FT                   VVEGVEDDAQLALLRRHGAPLAQGFLLGRPVPADQLDRSPAPAARA"
     atgagctctc gtccgagctt cagcgcgcca ttcggcgaac gaccccgcga gggcaagcgg        60
     gacggacgcc tcgtgagccg cggcctcgtc gtcgacgccg ctccccagca gcgcgcgcgg       120
     caggcgctgc gcgccgccga gcggctcagc cgcgccgtcg tcgacgggct ggaggagggc       180
     gtcctcgtgc tcgacgcgaa cctccatccg gtcagctgga acgcgagcgt gctgcggatc       240
     ctcggcgtga cgccggagca gctcgccgac gtcgagcagc tcgcgcaggc gcccgcgacg       300
     atgtcgctgc gctacgacag cggcaagccc gtcaccccgc gcgacaaccc cgcgctgcgg       360
     tcgctgaggc acggcgcgcc cgtgcgggcg acgctccacc gcgagacgga gaccggtcgc       420
     gagcgctgga taacgatcct cgcgcgcccg atcggcggcg cgcacggcac cagccgcaga       480
     ggcgtcgtct gcacgttcgc cgacgtgacc agcagcgtcg aggcggcacg gcggctgcgc       540
     gaggagcgcg accgcgccca gcattacctc gaggtcgcct ccacgctcgt cgtcgtgctc       600
     gacgccggcg gccgcgtcga gctggtcaac cgccagggct gcgagctgct cggctacgcc       660
     gagcacgagc tggtcggccg cgactggaac gagaccgtcg tgccgcccgg cgaccgccgc       720
     gacgcgcgcg ccgtcttcgc gcagctgctc gccggcgagc agctgccggc cgagcggggg       780
     gagacgttcc tgctgacgaa ggccggcgag gagcgcaaga tcgcatggcg caacgcggtc       840
     gtgcgcgacg cgaccggcac cgtcgcctcg gtgctctgct cgggcgagga cgtgaccgag       900
     cggcgccgcg cggaggcgca gctcgcctac ctcgcccacc acgaccgcct caccggcctg       960
     ccgaaccgcg cgccgctgga ggagcagctg cagcgcgacc tcgcgcgcgc ccgccgcacc      1020
     ggcggctcgg tcgcgctcgt gcaggtcggc ctcgacaact tcaagctcgt caacgactcg      1080
     ctcgggcacg cggccggcga cgcggtcctc agcgagacgg cgcagcgcgt cgcgcagctc      1140
     acgcgcgcgg gcgacgtgat cgcccgtcag ggcggcgacg agttcatgct gctgctcgac      1200
     tgcggcgcgg aggaggcgca ggtcgtcgcg cagctcgccg gcgaccgcgt gatggcggcg      1260
     ctggagcagc cgttcgccgt cgccggggcg gagttccaca tcggcgcctc gatcgggatc      1320
     gcgctcttcc ccggcaacgc caacaacgcc gagagcctct tcaagcacgc cgacatggcg      1380
     atgcaccagg ccaagcgcag cggcggcggc gccgtcgtct tctacgagcg cggtgccgcc      1440
     gaggcgcgcg agcggctgtc gctcacgagc cgcctgcgcc gcgcgatcga cggcgacgag      1500
     ctgcgcctcc acttccagcc gatctaccgc gtcgaggacg gcgtgctggt cgcggtcgag      1560
     gcgctcgtgc gctgggagga ccccgagcac gggctcgtgc cgccggccgg cttcatcccg      1620
     gtcgcggagg agacgggcct gatcgagggg atcggcagct gggtcgtcga ggcgctctgc      1680
     cggcaggcgt cgcgctgggc gcgcgagggc ttccgcccgc ggctctgctt caacctctcg      1740
     ccgcgccagc tgcgccagcc cgacctcgtc gactcgatcg cgcggacgat cgcccgccac      1800
     gagctgccgc ccggccagtt ctgcgccgag ctgaccgaga ccgccgtgct gagcgacgag      1860
     cgccgccaca gctcgctgct cgacgagctg cacgaggccg gtctcgcgat cgcgatcgac      1920
     gacttcggca gcggccattc gtcgctcgct cgcctgcgcg acctgccggt gcaggtgctg      1980
     aaggtcgacc gctcgttcct cagacgcgtg ccggaggacc cgggctcgac cgcgatcgtc      2040
     gccgccgtcc tggagctcgg caccgcgctc gggatgacga ccgtcgtcga gggcgtcgag      2100
     gacgacgcgc agctggcgct gctgcggcgt cacggcgccc cgctcgccca gggcttcctg      2160
     ctcggccggc ccgtccccgc cgaccagctc gaccgctcgc cggcgccggc ggcacgcgca      2220
     tga                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page