(data stored in ACNUC7421 zone)

EMBL: CP001854.PE187

CP001854.PE187       Location/Qualifiers
FT   CDS_pept        186894..188252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0187"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: ammonium
FT                   transporter; KEGG: ade:Adeh_2218 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48623"
FT                   /db_xref="GOA:D3F545"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3F545"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADB48623.1"
FT                   /translation="MTESLVLAARSLGEVTIDLDALWLVVAAVLVMFMQAGFACVEIGF
FT                   SRGRNAGAVVAKVLFNFSLVTLVWWACGFALAFGGGAWLLGDSGFFLHVGETISAGSPI
FT                   AGTVTSADTGYVFFQLAFCAVSFAIVWGTTLERIRFVAYPIYGVVFAALIYPLVAHSIF
FT                   GGGLLGDVGDGMQDFAGSTVVHLTGATGGLAALLLLGPRRGKYGPDGSPRAIPGHSMPM
FT                   FGVGVLILWLGWFGFNAGSTLTTAGARFAEVALVTNLAAAAGVIGATLTVWLLTRRLDV
FT                   GMIGNGAIGALVAITAPSGYIELWAAPLIGAVAGALVVVSVLAIDRKLDDPVGALSAHG
FT                   VAGVWGTLSCGLFAAPRLVDAPGVPGEAGLVYSGSFEQLGVQALGVLVAFLLVFTLSYL
FT                   TFAAIKALFGLRVTDEEEQEGLDIVEHGMYGYPEQFIVAGDGFGEGFDSLPER"
     atgaccgagt cgctcgtcct cgccgcgcgc tcgctcggcg aggtcacgat cgacctcgac        60
     gcgctctggc tcgtcgtcgc cgcggtgctc gtgatgttca tgcaggccgg cttcgcgtgc       120
     gtcgagatcg gcttctcgcg cggtcgcaac gccggcgcgg tcgtcgcgaa ggtgctgttc       180
     aacttctcgc tcgtgacgct cgtctggtgg gcgtgcggct tcgcgctcgc gttcggcggc       240
     ggcgcgtggc tgctgggcga ctccggcttc ttcctgcacg tcggcgagac gatctccgcc       300
     ggcagcccga tagccggcac ggtcacgtcc gcggacaccg gctacgtctt cttccagctg       360
     gcgttctgcg ccgtctcgtt cgcgatcgtg tgggggacga cgctggagcg gatccgcttc       420
     gtcgcctacc cgatctacgg cgtcgtcttc gcggcgctga tctacccgct cgtcgcccac       480
     tcgatcttcg gcggcggcct gctcggcgac gtcggcgacg ggatgcagga cttcgccggc       540
     tcgaccgtcg tccacctgac cggtgcgacc ggcggcctcg cggcgctgct gctgctcggc       600
     ccgcgcaggg gcaagtacgg gccggacggc tcgccgcgcg cgatccctgg ccattcgatg       660
     ccgatgttcg gcgtcggcgt gctgatcctg tggctcggct ggttcggctt caacgccggc       720
     tcgacgctga cgactgccgg cgcgcgcttc gccgaggtcg cgctcgtcac caacctcgcc       780
     gcagcggccg gcgtgatcgg cgcgacgctg acggtgtggc tgctgacgcg ccggctcgac       840
     gtcggcatga tcggcaacgg cgcgatcggc gcgctcgtcg cgatcacggc gccgagcggc       900
     tacatcgagc tgtgggcggc gccgctgatc ggcgcggtcg ccggcgcgct cgtcgtcgtc       960
     tcggtgctgg cgatcgaccg caagctcgac gatcccgtcg gcgcgctctc cgcgcacggc      1020
     gtcgccggcg tctgggggac gctctcgtgc ggcctgttcg cggcgccgcg gctggtcgac      1080
     gcgcccggcg tgccgggcga ggccgggctc gtctacagcg gctcgttcga gcagctggga      1140
     gtccaggcgc tcggcgtgct ggtcgcgttc ctgctcgtct tcacgctctc ctacctgacg      1200
     ttcgcggcga tcaaggcgct gttcggcctg cgcgtgacgg acgaggagga gcaggaaggg      1260
     ctcgacatcg tcgagcacgg catgtacggc tacccggagc agttcatcgt cgcgggcgac      1320
     ggtttcgggg agggcttcga ctcgctgccg gagcgatag                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page