(data stored in ACNUC7421 zone)

EMBL: CP001854.PE188

CP001854.PE188       Location/Qualifiers
FT   CDS_pept        188347..189177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0188"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: scl:sce0253
FT                   branched-chain-amino-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48624"
FT                   /db_xref="GOA:D3F546"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3F546"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADB48624.1"
FT                   /translation="MTVLRVRIDGQPRAVEDAVIPVTDEGLLRGDGVFEVLRLYAGRVF
FT                   ALDQHLERMERSADGLRLPFDAAAAREDVEVLEATADGADAIVRLVSTRGGRRIALLET
FT                   VPPMPATVRLATVTFSPSGPLDGCKTLSYAANALATRLAIEDGADQALFVRPDGDVLEG
FT                   PNFAVFLGFAADAPLVTPPLSAGILDSITRRRLIGLVPVVERPVHAAELRHVEEAFVAS
FT                   TLREVLPVRAIDGRAIGRVPGPRTSDAERAFSAHVAQQTATFAATTVGEGRAPA"
     atgacggtgc tgcgggtacg gatcgacggg cagccacggg ccgttgagga cgcggtgatc        60
     ccggtcaccg acgagggtct gctgcgcggc gacggtgtct tcgaggtcct gcgcctctac       120
     gcgggtcgcg tcttcgcgct cgaccagcac ctggagcgga tggagcgctc cgccgacggc       180
     ctgcgcctcc cgttcgacgc cgcggccgcg cgcgaggacg tcgaggtgct cgaggcgacg       240
     gcggacggcg ccgacgcgat cgtgcggctg gtgagcacgc gcggcgggcg gcggatcgcg       300
     ttgctggaga cggtcccgcc gatgccggcg acggttcggc tcgcgaccgt gacgttctcg       360
     ccatccggcc cgctcgacgg ctgcaagacg ctcagctacg cggccaacgc gctggcgacc       420
     cggctcgcga tcgaggacgg cgccgaccag gcgctcttcg tgcggccgga cggcgacgtg       480
     ctcgagggtc cgaacttcgc ggtcttcctc ggcttcgccg ccgacgcgcc gctcgtgacg       540
     ccgccgttga gcgccggcat cctcgactcg atcacgcgcc gccggctgat cggcttggtc       600
     ccggtcgtcg agcggcccgt gcacgccgcc gagctgcggc acgtcgagga ggcgttcgtc       660
     gcctcgacgc tgcgcgaggt gctgcccgtg cgcgcgatcg acgggcgcgc gatcggtcgc       720
     gtgccggggc cacggacgag cgacgccgag cgggcgttct cggcacatgt cgcgcagcag       780
     accgcgacgt tcgcggcgac gacggtcggc gaaggtcgag ctcccgccta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page