(data stored in ACNUC7421 zone)

EMBL: CP001854.PE189

CP001854.PE189       Location/Qualifiers
FT   CDS_pept        189246..190355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0189"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48625"
FT                   /db_xref="GOA:D3F547"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D3F547"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADB48625.1"
FT                   /translation="MPDKTLLMLTTGGTIAGNVARDDGDPEEHIDNEALATVIEPTAAR
FT                   LEETWGVRVRLESQRIDDVDSSDILPSHWIALVDAIQEKYDDYDGFIVTHGTNTMGYTC
FT                   AALSFALNNLNKPVVVTGSQVPFGWPGSDALMNLDNALRVATYPYDGGIRGVVCVFGSH
FT                   IITGTRAKKATEFDLDAFTSFSAAGLGRIGRIIYMNDEHLKRHHAYLARGGTQPALLAR
FT                   DLAVSNGFDTRILSFTEFPGMLPDLFQAALEGLVERDEPLIRGVVFRAFGAGDVSTHLH
FT                   PCFEYLKSKEVPVVVTTQAPNGNSNFRVNDPGKELATRELAIPAHDMSIEAITTKLAWL
FT                   LARGTSYAKMPAAMHEDLHGEISVFPDRR"
     atgcctgaca agaccctgct catgctcacg acgggcggaa ccatcgccgg caacgtcgcc        60
     cgcgacgacg gcgacccgga ggagcacatc gacaacgagg cgctcgcgac cgtgatcgag       120
     ccgaccgcgg cgcggctcga ggagacctgg ggggtcaggg tccggctcga gtcgcagcgg       180
     atcgacgacg tcgacagctc ggacatcctc ccgtcgcact ggatcgcgct cgtcgacgcg       240
     atccaggaga agtacgacga ctacgacggg ttcatcgtca cccacgggac gaacacgatg       300
     ggctacacgt gcgcggcact gtcgttcgcg ctcaacaacc tcaacaagcc cgtcgtcgtg       360
     accggctcgc aggttccctt cgggtggccg gggtcggacg cgctgatgaa cctcgacaac       420
     gcgctccgcg tcgcgacgta tccctacgac ggcggcatcc gcggcgtcgt ctgcgtgttc       480
     gggagccaca tcatcaccgg cacacgcgcg aagaaggcga ccgagttcga cctcgacgcg       540
     ttcacgtcgt tctccgccgc cggcctcggc cgcatcgggc gcatcatcta catgaacgac       600
     gagcacctca agcgacacca cgcgtacctc gcccgcggcg gcacgcagcc ggcgctgctg       660
     gcgcgcgacc tcgcggtcag caacggcttc gacacgcgga tcctctcgtt caccgagttc       720
     cccggcatgc tgccggacct cttccaggcg gcgctggagg ggctcgtcga gcgcgacgag       780
     ccgctgatcc gcggcgtcgt cttccgcgcc ttcggcgccg gcgacgtcag cacccacctg       840
     catccgtgct tcgagtacct caagtcgaag gaggtgccgg tcgtcgtcac gacgcaggcg       900
     ccgaacggga acagcaactt ccgcgtcaac gatcccggca aggagctggc gacgcgcgag       960
     ctcgccatcc ccgcgcacga catgagcatc gaggcgatca cgaccaagct cgcgtggctg      1020
     cttgcccgcg gcacgagcta cgcgaagatg ccggccgcca tgcacgagga cctgcacggc      1080
     gagatctccg tcttccccga tcgtcgttga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page