(data stored in ACNUC7421 zone)

EMBL: CP001854.PE190

CP001854.PE190       Location/Qualifiers
FT   CDS_pept        190362..192557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0190"
FT                   /product="1-alkyl-2-acetylglycerophosphocholine esterase"
FT                   /EC_number="3.1.1.47"
FT                   /note="KEGG: fph:Fphi_1520 L-asparaginase; PFAM:
FT                   Asparaginase/glutaminase; SMART: TIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48626"
FT                   /db_xref="GOA:D3F548"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D3F548"
FT                   /inference="protein motif:PRIAM:3.1.1.47"
FT                   /protein_id="ADB48626.1"
FT                   /translation="MPEIFFSYAHLDNELSEDNTHQFTDAVDHFRRVYTEIRKNRARPL
FT                   AEDELFFDQHSIRDGDLITKSTTDAAKECLVMLAFFSPNYFGSEGCRAEWRAFNDEQKR
FT                   GSAERARKLLIPIEVRPVDDVQLADEEGREWFTALTTADGLRRNITSEILLAKDTGPLY
FT                   AAVEQLDKTMDDHVTRVRGSSRGTEQTLGNVLVVKTPIRRNSLNDPAIAEDLTDAPGMK
FT                   WDRLDPVCVVYAGGTVGMVHQQDSDELHADYEMAAGVDTIVRYLRPKIAPLPFNIHFFS
FT                   LLQTIDSSNVTAANWVDLATLLQEQMSNYQGFVILHGTNTLAYTASALSFLLSDSITQP
FT                   VILTGAEVPLSVSNTDAVHNVEHAIRTAAHQAYNGPVRIPEVCVYWNNQLFRGNRVTKK
FT                   YASDRTASFHTPNMPVPLGTLANDRLAIDYEHVRRTPPDAAVHRQPQPIHDIAKPRVEV
FT                   MFIHPDMDFSDLEARFPPEMIDGLILLSYGPGNAPEDRDFLSMLDRLLSAGTIVVNITQ
FT                   CPYGRVELKLFETAATLFDLGVVDGYDMTLEAAYTKLLWAIARHGNRKQPGVREEIRKK
FT                   FQRCVAGEMSASVYTVSFGPSQTFHPHDGYLVSDIPKFDGEVDRHDITEVFLRLESLKL
FT                   PRDVTTAKVRVLFGRPPDTDAPEWAGNVLAEFTKTITAAERAAGEISKNLEITHPFRKC
FT                   FRNEGFDVSLCVEGIDEVEFTSLSVVIYTTAAWGRGK"
     atgccggaga tcttcttcag ctacgcccac ctcgacaacg agctgtcgga ggacaacacg        60
     catcagttca ccgatgcggt ggaccacttc cggcgcgtct acaccgagat ccgcaagaac       120
     cgcgcccggc cgctcgccga ggacgagctg ttcttcgatc agcactcgat ccgcgacggc       180
     gacctgatca ccaagagcac gaccgacgcc gccaaggaat gcctcgtcat gctcgcgttc       240
     ttctcgccga actacttcgg cagcgagggc tgccgcgcgg agtggcgcgc gttcaacgac       300
     gagcagaagc gaggctcggc agagcgggcg cgcaagctgc tgatcccgat cgaggtgcgg       360
     ccggtcgacg acgtccagct cgccgacgag gagggccgcg agtggttcac ggcgctgacg       420
     acggcggacg ggctgcgccg caacatcacg agcgagatcc tgctggcgaa ggacaccggc       480
     ccgctctacg ccgcggtcga gcagctcgac aagacgatgg acgaccacgt cacgagagtg       540
     cgcggcagct cgcgtgggac cgagcagacg ctcgggaacg tgctcgtcgt caagacgccg       600
     atcagacgca actcgctgaa cgatccggcg atcgcggagg acctgaccga cgcgccgggg       660
     atgaagtggg atcggctcga cccggtctgc gtcgtgtacg ccggcggcac ggtcgggatg       720
     gtccaccagc aggactccga cgagctgcac gccgactacg agatggcggc gggcgtcgac       780
     acgatcgtcc gctacctgcg gccgaagatc gcgccgctgc cgttcaacat acatttcttc       840
     tcgctgctcc agacgatcga ctcgtcgaac gtcaccgccg cgaactgggt cgacctcgcg       900
     accctgctgc aggagcagat gagcaactac cagggcttcg tgatcctgca cgggaccaac       960
     acgctcgcgt acacggcgag cgcgctctcg ttcctgctga gcgacagcat cacccagccc      1020
     gtgatcctga ccggggcgga ggtgccgctc tcggtcagca acaccgacgc ggtccacaac      1080
     gtcgagcacg cgatccgcac cgccgcgcat caggcgtaca acgggcccgt ccgcatcccc      1140
     gaggtctgcg tctactggaa caaccagctg ttccgcggga accgcgtgac gaagaagtac      1200
     gcgtccgacc gcacggccag cttccacacc ccgaacatgc cggtcccgct ggggacgctc      1260
     gcgaacgaca ggctcgcgat cgactacgag cacgtgcggc gcacgccgcc ggacgcggcg      1320
     gtccatcggc agccgcagcc gatccacgac atcgccaagc cgcgcgtcga ggtcatgttc      1380
     atccacccgg acatggactt cagcgacctc gaggcgcgct tcccgccgga gatgatcgac      1440
     gggctgatcc tgctctccta cggcccgggc aacgcgccgg aggaccgcga cttcctcagc      1500
     atgctcgatc ggctgctgag cgccgggacg atcgtcgtca acatcacgca gtgcccctac      1560
     ggccgcgtcg agttgaagct gttcgagacc gcggcgacgc tcttcgacct cggcgtggtc      1620
     gacggctacg acatgacgtt ggaggcggcg tacaccaagc tgctgtgggc gatcgcacgc      1680
     cacggaaacc gcaagcagcc gggcgtgcgg gaggagatcc gcaagaagtt ccagcgctgc      1740
     gtcgcgggcg agatgagcgc gagcgtctac accgtctcgt tcggaccgtc gcagacgttc      1800
     catccgcacg acggctacct ggtgtcggac atcccgaagt tcgacgggga ggtcgaccgg      1860
     cacgacatca ccgaggtctt cctgcgcctg gagagcttga agctgccccg tgacgtgacg      1920
     accgcgaagg tgcgcgtgct gttcggccgg ccgcccgaca ccgacgcgcc ggaatgggcg      1980
     ggcaacgtcc tcgccgagtt caccaagacg atcacggcgg ccgagcgcgc ggccggcgag      2040
     atcagcaaga acctcgagat cacgcatccc tttcgcaagt gcttccgcaa cgaaggtttc      2100
     gacgtctcgc tctgcgtcga gggaatcgac gaggtcgagt tcacctctct cagcgtcgtg      2160
     atctacacca ccgcggcatg gggccggggc aagtga                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page