(data stored in ACNUC7421 zone)

EMBL: CP001854.PE191

CP001854.PE191       Location/Qualifiers
FT   CDS_pept        192539..193906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0191"
FT                   /product="Aspartate racemase-like protein"
FT                   /note="KEGG: dda:Dd703_1302 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48627"
FT                   /db_xref="GOA:D3F549"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3F549"
FT                   /inference="protein motif:COG:COG1794"
FT                   /protein_id="ADB48627.1"
FT                   /translation="MGPGQVSAVVPEEVARNVAFLSDSGVWHVVSRNRPAFSCADAARK
FT                   RKRLSHRGQEVGIPLCDELKTAVCVVEHEHGQEFVVLHCRGHQLLDDDKLAAVLGAAVR
FT                   RMEPDELEQSFDLAYGLVTPFAFAERDDVRQVFDRTVIEPFFPPYTMMTNLGHHEYGVE
FT                   FQPRELVGALPRSSVEDIARGEGQRVPVEHTLGILTGNGPESGRFLWSRIDECIRNHPD
FT                   VPFRGDIGLPRVVVESVPEMGLSMELEERLSTVRPAVLDGVRRLCERGATVVGIACNTT
FT                   QYFVDDIREVCEAHGAQFVSIVEATAAALADEGIERVVFLGIGAVSDFDRWSDFRRIAG
FT                   EFAFDRPPDDLIDEIDDLAFLVKQRGIVSVTINPMRDIVRRAAASEDTVILVALTELSL
FT                   LVASQRRSRRRFVDTLQILAEAMAGIYIQERIPLDVGPEAAQEESAAARVPDAGSG"
     atggggccgg ggcaagtgag cgccgtcgtt ccggaggagg tcgcgcgcaa cgtcgcgttc        60
     ctgtcggaca gcggcgtctg gcacgtcgtg tcgcgcaacc ggccggcgtt cagctgcgcc       120
     gacgccgcgc gcaagcgcaa gcgcctctcc catcgcggcc aggaggtcgg gatcccgctg       180
     tgcgacgagc tgaagaccgc cgtctgcgtg gtcgagcacg agcacgggca ggagttcgtc       240
     gtcctgcact gccgcggaca ccagctgctc gacgacgaca agctcgccgc cgtgctcggc       300
     gccgcggtcc gccggatgga gccggacgag ctggagcagt cgttcgacct cgcctacggg       360
     ctcgtgacgc cgttcgcgtt tgccgagcgc gacgacgtgc ggcaggtctt cgaccgcacc       420
     gtgatcgagc cgttcttccc cccgtacacg atgatgacca acctcggtca ccacgagtac       480
     ggggtcgagt tccagccgcg cgagctggtc ggcgcgctgc cgcgctcgtc ggtcgaggac       540
     atcgcccgtg gcgaagggca gcgggtgccc gtcgagcaca cgctcggcat cctgaccggg       600
     aacggcccgg agtcgggccg gttcctctgg agccggatcg acgagtgcat ccgcaaccac       660
     ccggacgtgc cgttccgcgg tgacatcggc ctgccgcgcg tggtcgtcga gtcggtgccc       720
     gagatggggc tctcgatgga gctggaggag cggctgtcga ccgtccgccc ggccgtgctc       780
     gacggcgtgc ggcggctgtg cgagcgcggt gcgaccgtcg tcgggatcgc gtgcaacacg       840
     acgcagtact tcgtcgacga catccgcgag gtgtgcgagg cgcacggcgc gcagttcgtc       900
     tcgatcgtcg aggcgacggc ggcggcgctc gccgacgagg gcatcgagcg ggtcgtcttc       960
     ctcgggatcg gcgccgtctc cgacttcgac cgctggagcg acttccgccg catcgccggc      1020
     gagttcgcgt tcgatcgtcc gccggacgac ctgatcgacg agatcgacga tctcgcgttc      1080
     ctcgtcaagc agcgagggat cgtcagcgtg acgatcaacc cgatgcgcga catcgtccgg      1140
     cgggccgccg cgagcgagga caccgtgatc ctcgtcgcgc tgacggagct gtcgctcctc      1200
     gtcgcgtcgc agcgacgctc gcggcgccgg ttcgtcgaca cgctgcagat cctcgccgag      1260
     gcgatggccg gcatctacat ccaggagcgc atcccgctcg acgtcggtcc cgaggcggcg      1320
     caggaggaga gcgcggcggc acgagttccg gacgcgggca gcggctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page