(data stored in ACNUC7421 zone)

EMBL: CP001854.PE192

CP001854.PE192       Location/Qualifiers
FT   CDS_pept        193959..194945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0192"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: mms:mma_3667
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48628"
FT                   /db_xref="GOA:D3F550"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D3F550"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADB48628.1"
FT                   /translation="MAIQAHAGRRVRILGAGGTIAMRGTSATPQLGVAALVAAIPGLHA
FT                   GDGLEAFDVVNKPSPHLTLADQLEVCRQARDAARRGMGVVVTHGTDSLEETAMLCDVIH
FT                   DAEAPIVFTGAIRPATAAGADGPANLLDAVSVAASEEAAGMGVLVVFGGEIHHARCARK
FT                   TDTTSLVAFSSPQTGPLGRVTEGHPTIWSHLPRNPPFDPPVLDKRVLVVPTGAGDDGTL
FT                   ARAALSTEPDGVVIGTLGAGHLAPPLLELWADAAERIPVVAYCRPERGVVLTGTYGYAG
FT                   SEQDLRDTGIIPAGFLSPQAARMKLLACVASGLSVDEVRWAFSQDDG"
     atggccatcc aggcacatgc cggtcgtcgc gtgcgaatcc tgggcgccgg cgggacgata        60
     gcgatgcgcg gcacgtccgc tacgccgcag ctcggcgtcg cggcgctcgt cgccgcgatc       120
     ccagggctgc acgcgggcga cgggctcgag gcgttcgacg tcgtcaacaa gcccagcccc       180
     cacctcacgc tcgccgacca gctcgaggtc tgccgccagg cgcgcgacgc cgcccgccgc       240
     gggatgggcg tcgtcgtcac gcacggcacc gactcgctgg aggagacggc gatgctctgc       300
     gacgtgatcc acgacgccga ggcgccgatc gtcttcacgg gcgcgatccg tcccgcgaca       360
     gcggccggcg ccgacggccc ggcgaacctg ctcgacgccg tctcggtcgc ggcgagcgag       420
     gaggcggccg ggatgggcgt gctggtggtc ttcggcggcg agatccacca cgcccgctgc       480
     gcgcgcaaga cggacacgac ctcgctcgtc gccttctcct cgccgcagac cggcccgctg       540
     ggccgcgtca ccgagggcca tccgacgatc tggtcgcatc tcccccgcaa cccgccgttc       600
     gacccgccgg tgctcgacaa gcgggtgctc gtcgtcccga ccggcgccgg cgacgacggc       660
     acgctcgcgc gcgcggcgct ctcgaccgag cccgacggcg tcgtgatcgg cacgctcggc       720
     gccggccacc tcgcgccgcc gctgctggag ctgtgggccg acgccgctga gcggatcccg       780
     gtcgtcgcct actgccgccc cgagcgcggc gtcgtgctga ccggcaccta cggctacgcc       840
     ggctccgagc aggacctgcg cgacaccggg atcatcccgg ccggcttcct ctccccccag       900
     gccgcccgca tgaagctgct cgcgtgcgtc gcgagcgggc tgtcggtcga cgaggtccgc       960
     tgggcgttca gccaggacga cggctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page