(data stored in ACNUC7421 zone)

EMBL: CP001854.PE193

CP001854.PE193       Location/Qualifiers
FT   CDS_pept        complement(194949..195329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0193"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein; KEGG: dvm:DvMF_2629 cupin 2 conserved
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48629"
FT                   /db_xref="GOA:D3F551"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3F551"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB48629.1"
FT                   /translation="MHLARHAELEPYVTRDGSTIREWAGPGYSPARNQSLAEATLPPGR
FT                   ATTAHYHRAAEELYLFTAGRGRLRVGDAERDVQSGDCVVIPPGAVHKLWNTGDDDLVLV
FT                   CACSPAYSHEDTFLAEGEPDAG"
     atgcacctcg cccgccacgc agagctggag ccgtacgtca cgcgcgacgg ctcgacgatc        60
     cgcgagtggg ccgggccggg ctactcaccg gcgaggaacc agagcctcgc cgaggcgacg       120
     ctgccgcccg gcagagcgac caccgcccac taccaccgcg cggcggagga gctgtacctc       180
     ttcaccgccg gccgcggccg gctgcgcgtc ggcgacgcgg agcgcgacgt gcagtccggc       240
     gactgcgtcg tgatcccgcc cggcgcggtc cacaagctgt ggaacaccgg cgacgacgac       300
     ctcgtgctcg tctgcgcctg ctcccccgcg tactcgcacg aggacacgtt cctcgccgag       360
     ggtgagccgg acgccggctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page