(data stored in ACNUC7421 zone)

EMBL: CP001854.PE194

CP001854.PE194       Location/Qualifiers
FT   CDS_pept        195405..196082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0194"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5545
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48630"
FT                   /db_xref="GOA:D3F552"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3F552"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48630.1"
FT                   /translation="MNAMVQSTNGRSRLPRAQRELQILDIAHARFAERGYAAVTMDEVA
FT                   SAAGVTKPLLYAYFGNKERLYRACMERAGEAMLATVVEAIRAAEGPTEALRDGLRAFFA
FT                   FVDGDRDAWRVLFDETHPVGGELARSVADYRQRLVGLVAETQLALVPEHNRERAATEVE
FT                   ALSHALLGASEALARWWLRTGAMPPADAAELLVATVEPGLQARAALRFIPPTPEQTKEP
FT                   NDR"
     atgaacgcca tggtccagtc gaccaacggc cgcagccgcc ttccccgcgc ccagcgcgag        60
     ctgcagatcc tcgacatcgc gcacgcccgc ttcgccgagc gcggctacgc cgccgtcacg       120
     atggacgagg tcgcgagcgc ggccggcgtc acgaaaccgc tgctctacgc ctacttcggc       180
     aacaaggagc ggctctaccg cgcctgcatg gagcgcgccg gcgaggcgat gctcgcgacc       240
     gtcgtcgagg cgatcagagc ggcggagggc ccgaccgagg cgctgcgcga cggcctgcgc       300
     gcgttcttcg ccttcgtcga cggcgaccgt gacgcgtggc gcgtcctctt cgacgagacc       360
     catcccgtcg gcggcgagct ggcccgcagc gtcgccgact atcgccagcg gctcgtcggg       420
     ctcgtggccg agacgcagct cgcgctcgtg ccggagcaca accgcgagcg cgcggcgacc       480
     gaggtcgagg cgctctcgca cgcgctgctg ggcgcctccg aggcgctcgc gcgctggtgg       540
     ctgcgaaccg gcgcgatgcc gccggccgac gccgccgagc tgctcgtcgc gaccgtcgag       600
     cccggcctgc aggcacgcgc cgcgctgcgc ttcattcccc cgacaccaga acagaccaag       660
     gagcccaatg accgctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page