(data stored in ACNUC7421 zone)

EMBL: CP001854.PE195

CP001854.PE195       Location/Qualifiers
FT   CDS_pept        196072..197352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0195"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: pmy:Pmen_0745 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48631"
FT                   /db_xref="GOA:D3F553"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D3F553"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADB48631.1"
FT                   /translation="MTADGPRRVAVLGGNRIPFARSNSVYSKASNQDMLTAALDGLVSR
FT                   YGLEGERLGEVVAGAVLKHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVA
FT                   NKIRLGQIESGVAGGTDTTSDAPLAVNEDLREILLDANRKKSTQDKLKTLLRLRPQHLA
FT                   PAIPRNEEPRTGLSMGEHQARTAAEWGITREAQDALAVRSHKNLAAAYERGFQDDLVTP
FT                   YLGLERDQNLRPDSNVEKAAKLKPVFGGKDGTMTAANSTPLSDGAAVALLGSEAWAQEH
FT                   ELTPLAYFVDGEAAAVDYVHGKEGLLMAPAYAVPRMLARNGLTLQEFDLYEIHEAFASQ
FT                   VLSTLKAWEDPAFCTQRLGLDRPLGAIDRDKLNVNGSSLAAGHPFAATGGRIVAGLAKA
FT                   LHERGGGRGLISVCAAGGQGVVAILEA"
     atgaccgctg acggtccccg cagggtcgcc gtgctcggcg gcaaccgcat ccccttcgcg        60
     cgctcgaaca gcgtctactc gaaggcgtcc aaccaggaca tgctgaccgc cgcgctcgac       120
     ggtctcgtgt cgcgctacgg cctggagggc gagcggctcg gcgaggtcgt cgccggcgcc       180
     gtgctgaagc acagccgcga cttcaacctc acgcgcgagt gcgtgctcgg cagccgcctc       240
     gcgcccgaga cgcccgcgta cgacatccag caggcgtgcg gcacgggtct ggaggcagcg       300
     atcctcgtcg ccaacaagat ccgcctcggg cagatcgagt ccggcgtcgc cggcggcacc       360
     gacacgacgt cggacgcgcc gctcgccgtc aacgaggacc tgcgcgagat cctgctcgac       420
     gcgaaccgca agaagtcgac gcaggacaag ctcaagacgc tcctgcgact gcgcccgcag       480
     cacctcgcgc cggcgatccc gcgcaacgag gagccgcgca ccggcctctc gatgggcgag       540
     caccaggcgc gcacggcggc cgagtggggc atcacgcgcg aggcgcagga cgcgctggcc       600
     gtgcgcagcc acaagaacct cgccgccgcc tacgagcgcg gcttccagga cgatctcgtc       660
     acgccctacc tcgggctcga gcgcgaccag aacctgcgcc cggactccaa cgtcgagaag       720
     gccgcgaagc tgaagccggt cttcggcggc aaggacggca cgatgacggc ggccaactcg       780
     acgccgctgt ccgacggcgc cgccgtcgcg ctgctcggca gcgaggcgtg ggcgcaggag       840
     cacgagctca ccccgctggc gtacttcgtc gacggcgagg cggccgcggt tgactacgtc       900
     cacggcaagg aggggctgct gatggcgccc gcctacgccg tcccgcggat gctcgcgcgc       960
     aacggcttga cgctgcagga gttcgacctc tacgagatcc acgaggcgtt cgcctcgcag      1020
     gtgctctcga cgctgaaggc gtgggaggac ccggccttct gcacgcagcg gctcgggctc      1080
     gacagaccgc tcggcgcgat cgaccgcgac aagctcaacg tcaacggcag ctcgctcgcc      1140
     gccggccacc cgttcgccgc caccggcggc cgcatcgtcg cgggcctcgc gaaggcgctg      1200
     cacgagcgcg gcggcggccg cggcctgatc agcgtctgcg cagccggcgg ccagggcgtc      1260
     gtcgcgattt tggaggcata g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page