(data stored in ACNUC7421 zone)

EMBL: CP001854.PE196

CP001854.PE196       Location/Qualifiers
FT   CDS_pept        197356..198768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rpf:Rpic12D_0431 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48632"
FT                   /db_xref="GOA:D3F554"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F554"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48632.1"
FT                   /translation="MSDRYTDLINTPLGRLVQKQVGLPAPVPLKRYSPGDPAVDGRVLL
FT                   AGAPGGRLASALAAIVADTGAEASTPLREDLRAAAAEAGLDAGPWTPAAAATQRYGALV
FT                   FDATGISEPAELKALHDFFGATIRRVQRCGRVVVLGTTPSAASTPSEAIAQRALEGFTR
FT                   SVGKELKAGATAQLVYVAPGAEDQLASTLRFLLSPKSAYVDGQVIRVGEAGAVPAIDWE
FT                   QPLAGKVALVTGASRGIGAAIAATLARDGAHVVGLDVPALQSDLEAVTSALGGSALTLD
FT                   ITADDAPRAIAAHLRREHGGVDVVVHNAGITRDKTLARMDDDKWSSVIAVNLAAVQRIT
FT                   DALIAGRSRAVLNDGGRIVCVSSIAGVAGNFGQTNYATSKAGVIGVVESYAPLLAKQGA
FT                   TINAVAPGFIETQMTAKIPFATREVGRRMNSLSQGGLPVDVAEAIAYFASPASTGVTGN
FT                   VVRVCGQSLLGA"
     atgtccgacc gctacaccga cctcatcaac acgccgctcg gcagactcgt ccagaagcag        60
     gtcgggctgc cggcgccggt gccgctcaag cgctacagcc cgggcgatcc ggccgtcgac       120
     ggccgcgtgc tgctggccgg tgcgcccggc gggcggctcg cgagcgcgct cgccgcgatc       180
     gtcgccgaca ccggcgcgga ggcctcgacg ccgctgcgcg aggacctgcg cgcggccgcg       240
     gcggaggccg gtctggacgc cggcccgtgg acgccggccg ccgccgcgac gcagcgctac       300
     ggcgcgctcg tcttcgacgc gaccgggatc tcggagccgg ccgagctgaa ggcgctgcac       360
     gacttcttcg gcgcgacgat ccgccgcgtc cagcgctgcg gccgcgtcgt cgtgctcggc       420
     acgaccccga gcgcggcgag cacgccgagc gaggcgatcg cgcagcgtgc gttggaaggc       480
     ttcacccgct cggtcggcaa ggagctgaag gcgggcgcga ctgcgcagct cgtctacgtc       540
     gcgcccggcg ccgaggacca gctcgcctcg accctgcgct tcctgctgtc gccgaagtcg       600
     gcctacgtcg acggccaggt gatccgcgtc ggcgaggccg gcgcggtccc cgcgatcgac       660
     tgggagcagc cgctcgccgg caaggtcgcg ctcgtgaccg gcgcctcgcg cggcatcggc       720
     gccgcgatcg ccgcgacgct cgcgcgtgac ggcgcgcacg tcgtcggcct cgacgtgccg       780
     gcgctgcaga gcgacctcga agccgtgacg agcgcgctcg gcggctcggc gctgacactc       840
     gacatcaccg ccgacgacgc gccgagagcg atcgccgcgc acctcagaag agagcacggc       900
     ggggtcgacg tggtcgtcca caacgcgggc atcacgcgcg acaagacgct cgcgcggatg       960
     gacgacgaca agtggagcag cgtcatcgcc gtcaacctcg ccgccgtcca gcggatcacc      1020
     gacgcgctga tcgcgggcag aagcagagcg gtcctgaacg acggcggccg gatcgtctgc      1080
     gtctcctcga tagcgggcgt cgccggcaac ttcgggcaga ccaactacgc gacctcgaag      1140
     gcgggcgtga tcggcgtcgt ggagtcctac gcgccgctgc tggccaagca gggcgcgacg      1200
     atcaacgccg tcgcccccgg cttcatcgag acgcagatga cggcgaagat cccgttcgcc      1260
     acgcgcgagg tcgggcgtcg catgaactcg ctctcccaag gcgggctgcc ggtcgacgtc      1320
     gccgaggcga tcgcctactt cgccagcccc gcctcgaccg gcgtcaccgg caacgtcgtc      1380
     cgcgtctgtg gccagagcct gctgggggcc tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page