(data stored in ACNUC7421 zone)

EMBL: CP001854.PE197

CP001854.PE197       Location/Qualifiers
FT   CDS_pept        198770..199663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0197"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   abo:ABO_1719 MaoC like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48633"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F555"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB48633.1"
FT                   /translation="MASAPTSTTRELSAPPCTATLYAKAALPLIPGASALPFVAGGGKT
FT                   IPRTTLTLNGVTADPDQLVSYDRVCGFTLRDTLPSTYLHIRAFPLHMALMTDGSFPFGA
FT                   VGLVHLRNRITQLRPVGTTETFDLRVHTMPVQPHPKGRTFTIVSEARVGDELVWQDAST
FT                   MLTRGKGSGGQEPRPVDDGPAPKDLPFVAEWRLAEDLGRRYGAASGDRNPIHMHALSAK
FT                   LLGFPRAIAHGMWTKARCLAALESTLPDAYTVDVTFRRPILLPGKVAFAAEDGRFAVRN
FT                   VKDSSKIHLEGRVTAA"
     gtggcgtccg ccccgacatc cacgacgcgc gagctgagcg caccgccctg cacggcgacg        60
     ctctacgcga aggcggcgct gccgctgatc ccgggcgcct ccgcgctccc attcgtcgcc       120
     ggcggcggga agacgatccc gagaacgacg ctgacgctga acggcgtcac cgccgacccg       180
     gaccagctcg tctcctacga ccgcgtctgc ggcttcacgc tgcgcgacac gctcccgtcg       240
     acctacctgc acatccgcgc gttcccgctg cacatggcgc tgatgaccga cggctcgttc       300
     ccgttcggcg cggtcggcct cgtccacctg cgcaaccgca tcacgcagct gcgcccggtc       360
     gggacgacgg agacgttcga cctgcgcgtc cacacgatgc cggtccagcc gcacccgaag       420
     ggcaggacgt tcacgatcgt cagcgaggca cgcgtcggcg acgagctggt gtggcaggac       480
     gcctcgacga tgctgacgcg cggcaagggc agcggcgggc aggagccgcg cccggtcgac       540
     gacgggccgg cgccgaagga cctgccgttc gtcgcggagt ggcggctcgc agaggatctc       600
     ggccgccgct acggcgccgc gtccggcgac cgcaacccga tccacatgca cgcgctcagc       660
     gcgaagctgc tcggcttccc gcgcgcgatc gcgcacggga tgtggacgaa ggcgcgctgc       720
     ctggcggcgc tggagtcgac gctgccggac gcgtacacgg tcgacgtgac gttccgccgg       780
     ccgatcctgc tgccgggcaa ggtcgcgttc gcggccgagg acgggcggtt cgccgtccgc       840
     aacgtcaagg acagctcgaa gatccatctc gaaggaaggg tgactgccgc gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page