(data stored in ACNUC7421 zone)

EMBL: CP001854.PE198

CP001854.PE198       Location/Qualifiers
FT   CDS_pept        199681..200976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0198"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: abo:ABO_1701
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48634"
FT                   /db_xref="GOA:D3F556"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F556"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48634.1"
FT                   /translation="MGLGLRALGRFAGSDLVDKLGIRKQSEAVVYRATRDGFRAVGAAN
FT                   RTFKQVSTNGKKPARLKPSGSGVFDLTPSDEQQMLGEAFGEFGAERLRPNALKADAAAQ
FT                   APPELLAEAAELGLTMLGVPEDLGGAVSERSSVTAVLAAEALSHGDMGLAAAALAPAGV
FT                   ATALSLWGDAEQQETYLPALIGEDVAVAALAIHEPRPLFDPFELETTARIDGADYVLSG
FT                   VKSFVPRATEAELLVVAARIAGHGPGLFLVETKSDGVLAKAAPGMGVRAAAVGEVLLEE
FT                   VRVPARALLGDGSPAVYADAVRRARLAWCALAIGTGKAVLDYVIPYVNERVAFGEPISH
FT                   RQSVAFAVSNIAIELEGMRLATLRAASRADMEKEFAREVALARHLCSEKGAWIGSEGVQ
FT                   LLGGHGYIKEHPVERWYRDLRAVGVVEGALLV"
     atgggcctgg gcctgcgggc gctcggccgt ttcgcagggt cggacctcgt cgacaagctc        60
     ggcatccgca agcagtccga ggccgtcgtc taccgcgcca cccgcgacgg cttccgcgcc       120
     gtcggcgccg ccaaccgcac gttcaagcag gtctcgacga acggcaagaa gccggcccgc       180
     ctgaagccct cgggctccgg cgtgttcgac ctgacgccga gtgacgagca gcagatgctc       240
     ggcgaggcgt tcggcgagtt cggcgccgag agactgcgcc cgaacgcgct gaaggccgac       300
     gcggctgccc aggcgccgcc ggagctgctg gccgaggcgg ccgagctggg cctgacgatg       360
     ctcggcgtcc cggaggacct cggcggcgcc gtcagcgagc gctcgtcggt cacggccgtg       420
     ctcgccgcag aggcgctgtc gcatggcgac atggggcttg ccgccgccgc gctcgcgccg       480
     gccggcgtcg cgaccgcgct gagcctgtgg ggggacgccg agcagcagga gacctacctg       540
     ccggcgctga tcggcgagga cgtcgcggtc gccgcgctgg cgatccacga gccgcgcccg       600
     ctgttcgatc cgttcgagct ggagacgacc gcgcggatcg acggcgccga ctacgtcctc       660
     agcggcgtca agtcgttcgt tccgcgcgcg accgaggccg agctgctggt cgtggcggcg       720
     agaatcgccg ggcacggccc gggcctcttc ctcgtcgaga ccaagagcga tggcgtgctc       780
     gcgaaggcgg cgcccgggat gggcgtgcgc gccgccgccg tcggcgaggt gctgctggag       840
     gaggtgcgcg tccctgcgcg ggcgctgctc ggcgacggct cccccgccgt ttacgccgat       900
     gccgtccgcc gtgcccggct cgcctggtgc gcgctggcga tcggcaccgg caaggccgtg       960
     ctcgattacg tgatcccgta cgtcaacgag cgcgtcgcgt tcggcgagcc gatctcgcac      1020
     cgccagtcgg tcgcgttcgc ggtctcgaac atcgcgatcg agctggaggg gatgcgcctg      1080
     gcgacgctgc gcgccgcctc ccgcgccgac atggagaagg agttcgcccg cgaggtcgcg      1140
     ctcgcgcggc acctgtgcag cgagaagggc gcgtggatcg gctccgaggg cgtgcagctg      1200
     ctcggcggcc acggctacat caaggagcac ccggtcgagc gctggtaccg cgacctgcgt      1260
     gccgtcggcg tcgtcgaggg cgccctgctc gtctag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page