(data stored in ACNUC7421 zone)

EMBL: CP001854.PE199

CP001854.PE199       Location/Qualifiers
FT   CDS_pept        200989..202209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0199"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: aci:ACIAD1412
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48635"
FT                   /db_xref="GOA:D3F557"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F557"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48635.1"
FT                   /translation="MTMNLEVPKKFLPLVGQAHQVAEEIFRPVSRKYDQEEHAYPRELD
FT                   MLAALLDGMNDGSDMGGGAGAGGVRRQENSNGEIRNGSNMSTALGVAELCWGDVGLLLT
FT                   MPRQGLGNSAIASVANDEQLERFRGKWAAMAITEPEAGSDSAAIRTTAVLDRETGEYVL
FT                   NGEKIYVTSGERADLVVVWATLDRSLGRAAIKSFVVERSNPGMILDRLEHKLGIRASDT
FT                   AAFRLENCRVKPENLLGSPEVDVKRGFAGVMQTFDNTRPLVAAMAVGLTRACLEQTKEL
FT                   LAEAGVEVDYDKPAQSQPAAAAEYLSMEADYEAARLLTLEATWMADNSKPNSLQASYAK
FT                   AKAGRTCVDVAMRCVRLAGSRGYGEELLLEKWARDGKILDIFEGTQQIQLLIIARQLLG
FT                   KTSAELR"
     atgacgatga atctcgaagt cccgaagaag ttccttccgc tcgtcggtca ggcgcaccag        60
     gtcgcggagg agatcttccg cccggtctcg cgcaagtacg accaggagga gcacgcatat       120
     cccagagagc tcgacatgct ggcggcgctg ctcgacggca tgaacgacgg ctccgacatg       180
     ggcggcggcg cgggcgctgg cggcgtgcgg cggcaggaga acagcaacgg cgagatccgc       240
     aacggctcga acatgtcgac cgcgctcggc gtcgccgagc tgtgctgggg cgacgtcggc       300
     ctgctgctga cgatgccgcg ccaggggctc ggcaactcgg cgatcgcgtc ggtcgccaac       360
     gacgagcagc tggagcgctt cagaggcaag tgggcggcga tggcgatcac cgagcccgag       420
     gccggctcgg actcggccgc gatccgcacg accgccgtgc tcgacagaga gaccggcgag       480
     tacgtcctca acggcgagaa gatctacgtg acgtcgggag agcgcgccga cctcgtcgtc       540
     gtgtgggcga cgctcgaccg cagcctcggc cgcgcggcga tcaagtcgtt cgtcgtcgag       600
     cgctccaacc ccggcatgat cctcgaccgg ctggagcaca agctcggcat tcgcgcctcc       660
     gacacggcgg cgttccggct cgagaactgc cgtgtgaagc cggagaacct gctcggctcg       720
     cccgaggtcg acgtcaagag aggcttcgcg ggcgtcatgc agacgttcga caacacgcgg       780
     ccgctcgtcg ccgcgatggc ggtcggactg acgcgcgcct gcctggagca gacgaaggag       840
     ctgctcgccg aggccggcgt cgaggtcgac tacgacaagc cggcgcagtc gcagccggcg       900
     gcggccgccg agtacctgtc gatggaggcc gactacgagg cggcgcggct gctgacgctg       960
     gaggccacct ggatggccga caactcgaag ccgaactcgc tgcaggcctc ctacgcgaag      1020
     gcgaaggccg gccgcacgtg cgtcgacgtc gcgatgcgct gcgtgcgcct cgccggcagc      1080
     cgcggttacg gcgaggagct gctgctggag aagtgggcgc gcgacggcaa gatcctcgac      1140
     atcttcgagg gcactcagca gatccagttg ctgatcatcg cccggcagct gctcggcaag      1200
     acctccgccg agctgagata g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page