(data stored in ACNUC7421 zone)

EMBL: CP001854.PE2

CP001854.PE2         Location/Qualifiers
FT   CDS_pept        1570..2679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aeh:Mlg_0002 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48438"
FT                   /db_xref="GOA:D3EYQ5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADB48438.1"
FT                   /translation="MKISAAREELLAQLQTVSRVASTRGAIQALSGVQLIAAGGRVELR
FT                   ATDMEVGLRVPLPAEIEREGSVVLPARLIVDVVRSLSGPTATLELRPAEQDVELVAGNA
FT                   QFHIRTLRAEDFPPFPEPESEGVVSVPAKAFVETVLRVANSASRDETRPVLTGIMVSAS
FT                   ERELRMVATDSYRLSVKETTLEEPLVGGFEANVPARALQELARLVQQIDGEQLSVGVRQ
FT                   NQVVFQIGEVVLSSRLIEGQFPNYRQLLPDSYEHELTITGSEVTDVVRRISLLAQKNAP
FT                   LRLSFAPGELTVSAQTPDIGEARESLPVAFQGEPFEIGFNPDFLRDGLESVGSGDVMLK
FT                   LISPLRPGLIQSAEDGGFLYLIMPIRLNV"
     gtgaagatct cggccgcgcg cgaggaactg ctcgcccagc ttcagaccgt cagccgcgtc        60
     gcctcgacgc gcggcgcgat ccaggcgctc tccggcgtcc agctgatcgc cgcgggtggg       120
     cgggtcgagc tgcgcgccac cgacatggag gtcggtctcc gcgtcccgct ccccgccgag       180
     atcgagcgcg agggctccgt cgtactcccg gcgcgtctga tcgtcgacgt cgtgcgctcg       240
     ctctcgggac cgaccgcgac gctcgagctg cggcccgccg agcaggacgt cgagctggtc       300
     gccggcaacg cgcagttcca catccgcacg ctgcgcgccg aggacttccc gccattcccc       360
     gagccggagt ccgagggcgt cgtgagcgtt ccggcgaagg cgttcgtcga gaccgtcctg       420
     cgcgtcgcca actccgcctc ccgcgacgag acgcgcccgg tcctgaccgg catcatggtc       480
     tcggccagcg agcgtgagct gcggatggtc gcgaccgact cctaccgcct cagcgtcaag       540
     gagacgacgc tggaggagcc gctcgtcggc ggcttcgagg cgaacgtccc ggcgcgcgcg       600
     ctgcaggagc tcgcgcggct cgtgcagcag atcgacggcg agcagctgag cgtcggcgtg       660
     cggcagaacc aggtcgtctt ccagatcggc gaggtcgtgc tgtcctcgcg gctgatcgag       720
     ggccagttcc ccaactaccg ccagctgctg cccgacagct acgagcacga gctgacgatc       780
     accggcagcg aggtcaccga cgtcgtgcgc cgcatcagcc tgctggcgca gaagaacgcg       840
     ccactgcggc tgtcgttcgc gcccggcgag ctgacggtct ctgcacagac gcccgacatc       900
     ggcgaggcga gagagtcgct gccggtcgcc ttccagggcg agccgttcga gatcggcttc       960
     aacccggact tcctgcgcga cggactcgag tcggtcggct ccggcgacgt catgctgaag      1020
     ctcatcagcc cgctgcggcc cggcctgatc cagtcggcgg aggacggcgg cttcctctac      1080
     ctgatcatgc cgatccgcct gaacgtgtaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page