(data stored in ACNUC7421 zone)

EMBL: CP001854.PE20

CP001854.PE20        Location/Qualifiers
FT   CDS_pept        complement(24438..24899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0020"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   gme:Gmet_0441 flagellar assembly protein FliW"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48456"
FT                   /db_xref="GOA:D3EYQ3"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ3"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADB48456.1"
FT                   /translation="MPLTIDSTRFGQIEVEPDSVIEFPHGLIGFESRRFALVARETDAD
FT                   FLWLHSLEDPALAVPVTDPRRFFSGYSVELADEERERLGLAEPTATDIYVTVRASDQLE
FT                   GFTANLRAPIVISAGRGHQVINQAAEAPLRAPLFGELAEEAANAAGRAA"
     ttgccgctca cgatcgacag cacgcgcttc gggcagatcg aggtcgagcc cgacagcgtg        60
     atcgagttcc cgcacggact gatcggcttc gagagccggc gcttcgcgct cgtcgcgcgc       120
     gagaccgacg ccgacttcct ctggctgcac tcgctggagg accccgcgct ggccgtcccg       180
     gtgaccgatc cgcgccgctt cttcagcggc tattccgtcg agctcgccga cgaggagcgc       240
     gagcggctcg gcctggcgga gcccaccgcg accgacatct atgtcaccgt tcgggcaagc       300
     gaccagctcg agggcttcac ggcgaacctg cgcgcaccga tcgtcatctc cgcgggccgc       360
     ggccaccagg tcatcaacca ggcggccgag gccccgctgc gagcgccgct cttcggcgag       420
     ctcgcggagg aggcggcgaa cgccgcggga cgcgccgcct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page