(data stored in ACNUC7421 zone)

EMBL: CP001854.PE200

CP001854.PE200       Location/Qualifiers
FT   CDS_pept        complement(202244..203032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0200"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   pol:Bpro_2070 peptidase S51, dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48636"
FT                   /db_xref="GOA:D3F558"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3F558"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ADB48636.1"
FT                   /translation="MTDPRRILAMGGGGFTMEPDNPALDDYALSLTAAREPRVLFLPTA
FT                   SGDPTAQITSFYGRFGRTASATHLSLFRRHGSARSLAEIVLEQDVIYVGGGSMRNLLAI
FT                   WSAHELDTLLIEAWTRGIVLVGLSAGAMCWFEGGITRSGGPPETLLGLGLLPGSFTVHA
FT                   DGEPERLPVWLAALRSGELPGGWAADDGVALLFHGTRMVRAVSSRPGTAALKADMVGGE
FT                   LVRHRIEPELLGSGPHSPLDAPVGDDIRELRDLRYGMRHR"
     atgaccgacc cgcgccgcat cctcgcgatg ggcgggggcg gcttcacgat ggagccggac        60
     aacccggcgc tcgacgacta tgcgctgtcg ctgaccgccg cgcgcgagcc gcgcgtgctg       120
     ttcctgccga ccgcctccgg cgacccgacc gcgcagatca cctccttcta cggccgcttc       180
     ggccgcaccg cgtcggcgac gcacctgtcg ctcttccgcc gccacggctc ggctcgctcg       240
     ctcgccgaaa tcgtgctgga acaggacgtg atctacgtcg gcggcggctc gatgcgcaac       300
     ctgctggcga tctggagcgc gcacgagctg gacacgctgc tgatcgaggc gtggacgcgc       360
     gggatcgtcc tcgtcggcct cagcgctggc gcgatgtgct ggttcgaggg cggcatcaca       420
     cgctccggcg ggccgccgga gacgctgctc ggcctcggcc tgctgcccgg ctcgttcacc       480
     gtccacgccg acggcgagcc ggagcggctg ccggtctggc tcgcggcgct cagaagcggc       540
     gagctgcccg gcggctgggc cgccgacgac ggtgtcgcgc tgctgttcca cggcacacgg       600
     atggtgcgag cggtcagctc gcgccccggg accgcggccc tcaaggccga catggtcggc       660
     ggcgagctgg tcaggcaccg gatcgagccc gagctgctcg gcagcggccc gcacagcccg       720
     ctcgacgcac cggtcggcga cgacatccgc gagctgcgcg acctgcgcta cgggatgcgc       780
     caccgctag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page