(data stored in ACNUC7421 zone)

EMBL: CP001854.PE201

CP001854.PE201       Location/Qualifiers
FT   CDS_pept        complement(203029..203778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0201"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG: vpa:VPA1746
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48637"
FT                   /db_xref="GOA:D3F559"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3F559"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ADB48637.1"
FT                   /translation="MTTRPPQIVAFGGGGFSMEAGNPLLDDYVLSLTGVERPRVCFVPT
FT                   ASGDADHYVVRFYRTFSMQCETSHVSLFRRDRGSGAVEGDLEEHLLSQDVIYVGGGSVV
FT                   SLLGAWRAHGLDRILKAAWRKGVVLCGLSAGSLCWFAEAVTAFHGAPSVVRGLGLLPFS
FT                   NCVHYDGEPARREEYRRFVGDGVRPGYAADDGAALHFEHRQLKHVVSSRPRAQAYRVEP
FT                   VGSEIAESPLHARYLGERMPDMLMATA"
     atgacgacgc gacccccaca gatcgtcgca ttcggcggcg gcgggttctc gatggaggcc        60
     ggcaacccgc tgctggacga ctacgtgctg tcgctgaccg gcgtcgagcg gccgcgcgtc       120
     tgcttcgtcc cgaccgcgtc gggagacgcc gaccactacg tcgtgcgctt ctaccgcacg       180
     ttctcgatgc agtgcgagac gtcgcacgtc tcgctcttcc gccgcgaccg cggcagcggc       240
     gcggtcgagg gcgacctcga ggagcacctg ctgagccagg acgtgatcta cgtcggcggc       300
     ggcagcgtcg tctcgctcct gggggcgtgg cgcgcgcacg gcctcgaccg gatactgaag       360
     gccgcgtggc gcaagggcgt cgtcctgtgc ggcctctccg ccggctcgct gtgctggttc       420
     gccgaggcgg tcaccgcctt ccacggcgcg ccgagcgtcg tgcgcgggct cggcctgctg       480
     ccgttctcca actgcgtcca ctacgacggg gagccggcgc ggcgcgagga gtaccgccgc       540
     ttcgtcggcg atggcgtgcg acccggctac gccgccgacg acggcgccgc cctgcacttc       600
     gagcaccgcc agctcaagca cgtcgtcagc tcgcggccga gagcgcaggc gtaccgcgtc       660
     gagccggtcg gcagcgagat cgccgagtcg ccgctgcacg ccaggtacct cggcgagcgg       720
     atgccggaca tgctgatggc aactgcatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page