(data stored in ACNUC7421 zone)

EMBL: CP001854.PE202

CP001854.PE202       Location/Qualifiers
FT   CDS_pept        complement(203867..205255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0202"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mxa:MXAN_3943
FT                   cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48638"
FT                   /db_xref="GOA:D3F560"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D3F560"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADB48638.1"
FT                   /translation="MAPAAPDTRSLPPGPTGPRVLTVSRFLLQPTRFVGECRERYGRLF
FT                   TIRLSPGRTVVVAADAAVAKEVFTGDPALLHAGEGNVVLRPLLGPRSVLLLDGPEHLRQ
FT                   RRLMLPPFHGERMRGYGERMRAIADRHVAQWPVGEPFAVQRSMQAITLEVILRVVFGVE
FT                   EPARVAQLSAPLRRLLDSTEQPWRLLALQLTRSEGARPRTPWGRVRRLLAPVDAMIYEE
FT                   IAARRAELESGRPTRDDILTLLLSARDEDDQPLTDAELRDELMTLLLAGHETTATALTW
FT                   TLERITRHPEVLARLEAEVGGEGADAYLDAVIKETLRLRPVVPAVVRKLQAPLTFGGWD
FT                   LPAGVNIAPNIWLIHRDPALYPEPEAFRPERFLDRTPGTYEWLPFGGGIRRCLGASFAL
FT                   YEMRMVLSTILERTRLAPTTDAPEQVTRRFVTFSPASGGRVTITQRLTPAAAGSAAPQP
FT                   RVPA"
     atcgccccgg ccgcgcccga cacccgctcg ctcccgcccg gaccgaccgg tccgcgcgtc        60
     ctgacggtct cgcgcttcct gctgcagccg acacgcttcg tgggcgagtg ccgcgagcgc       120
     tacggcagac tcttcacgat caggctgtcc cccgggcgca cggtcgtggt cgccgccgac       180
     gcggcggtcg cgaaggaggt cttcaccggc gacccggcgc tgctgcacgc cggcgagggc       240
     aacgtcgtgc tgcggccgct gctggggccg cgctcggtgc tgctgctcga cggtcccgag       300
     cacctgcgcc agcggcggct gatgctgccg ccgttccacg gcgagcggat gcgcggctac       360
     ggcgagcgga tgcgcgcgat cgcggaccgc cacgtggcgc agtggccggt cggcgagccg       420
     ttcgcggtcc agcgctcgat gcaggcgatc acactggagg tgatcctgcg cgtcgtcttc       480
     ggcgtcgagg agccggcgcg cgtggcgcag ctgtcggcgc cgctgcggcg gctgctcgac       540
     tcgaccgagc agccgtggcg gctgctcgcg ttgcagctga cgagatcgga gggcgcgcgc       600
     ccgcgcacgc cgtggggccg cgtgcgccga ctgctggcgc cggtcgacgc gatgatctac       660
     gaggagatcg cggcacggcg ggcggagctg gagtccggcc ggccgacgcg cgacgacatc       720
     ctcacgctgc tgctgtccgc gcgtgacgag gacgaccagc cgctgacgga tgccgagctg       780
     cgcgacgagc tgatgacgct gctgctggcc ggccacgaga cgacggcgac cgcgctcacc       840
     tggacgctgg agcggatcac ccgccacccg gaggtgctcg cgcggttgga ggccgaggtc       900
     ggcggcgagg gtgccgacgc ctacctcgac gccgtgatca aggagacgct gcggctgcgc       960
     ccggtcgtgc cggcggtggt gcgcaagctg caggcgccgc tgacgttcgg cggctgggac      1020
     cttcccgccg gcgtcaacat cgcgccgaac atatggctga tccaccgcga cccggcgctc      1080
     taccccgagc ccgaggcgtt ccggccggag cggttcctcg acagaacgcc cggcacgtac      1140
     gagtggctgc cgttcggcgg cgggatccgc cgctgcctcg gcgccagctt cgcgctctac      1200
     gagatgcgca tggtgctgtc gacgatcctg gagcggacgc gcctggcgcc gacgaccgac      1260
     gcgccggagc aggtcacgcg ccgcttcgtc acgttcagcc ccgcatccgg cggacgcgtg      1320
     acgatcaccc agcgcctcac ccccgccgcc gccggttcgg ccgcgccgca gccgcgcgtc      1380
     ccggcctga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page