(data stored in ACNUC7421 zone)

EMBL: CP001854.PE203

CP001854.PE203       Location/Qualifiers
FT   CDS_pept        complement(205265..205603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48639"
FT                   /db_xref="GOA:D3F561"
FT                   /db_xref="UniProtKB/TrEMBL:D3F561"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48639.1"
FT                   /translation="MQRLPSWPIAAGSLLLGFAVADVTGVRPLGGIVLFLGALWCGLRW
FT                   RREQGLAVAVALVAAFLAAFVLSHPLGKAIGSWPAVLVVSAFVGTIVWARVDRVAPPGT
FT                   GVSAAPSR"
     gtgcagcgtc tcccctcctg gccgatcgcg gccggatccc tgctcctcgg cttcgccgtc        60
     gccgacgtga ccggcgtccg cccgctcggc gggatcgtgc tgttcctcgg cgcgctgtgg       120
     tgcggattgc gttggcgccg cgagcagggg ctcgcggtcg cggtcgcgct cgtcgccgcg       180
     ttcctggcgg cgttcgtgct ctcccacccg ctcggcaagg cgatcggctc gtggccggcg       240
     gtgctcgtcg tctcggcgtt cgtcgggacg atcgtgtggg cgcgcgtgga ccgtgtcgcg       300
     ccaccgggaa ccggcgtgtc ggccgcaccg tcgcgctag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page