(data stored in ACNUC7421 zone)

EMBL: CP001854.PE204

CP001854.PE204       Location/Qualifiers
FT   CDS_pept        complement(205641..207971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0204"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48640"
FT                   /db_xref="GOA:D3F562"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D3F562"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADB48640.1"
FT                   /translation="MKSNDRGGLHRLGRFCVRRHRLVLLVWVLGAVGLGVWAGQLGTQT
FT                   NDNVSLPGTDSQRAADVLDRDFSSGASNGTNPIVLRAPAGVRLTDAAERRAVTAIAAAY
FT                   ARDPGVRAVVSPLEPAGASQLSRDARIGYLGLSLRDSPSTLTLSEAERLLSVAQDAARP
FT                   AGLQVAAGGYLGADLSQAGSADSEAIGLLAAVVVLLFTFGTVVAMGLPLLTAILGLGTG
FT                   LSLITLASHVVQVPSTAPALATMIGLGVGIDYALFVVTRHREQMAAGVELRESIARAVA
FT                   TSGSAVVFAGGTVVIALCSLLLTGIPLVQQMGCLAAIAVLVAVLAAITLLPAALAAVGP
FT                   RIDSLALPWVRRARREAEAERARAASAGAPAAGSAAASAAPASDSATASATSAASAAPA
FT                   SAGAAAPAHPTMWLRWARLVADRPWPALVVALLVLGALAWPLTSLDLGQSDTGQLPRDT
FT                   TARQAYDMLAEGFGAGSNGPLLIAVRLPADAARASAEAVAGRLAAALRATPGVAAVGPP
FT                   LPAPRGDALLLTLTPTTAPSAPATEALVRHLRADTIPAALGDSGTAAFVGGSTAGYIDL
FT                   ADEIRDRLPLVIAVVLTLSFLLLTLAFRSLIVPLKAVLMNLLSIGAAFGVVSFVFSHDW
FT                   SAQLLGVEGAAPIVSFVPLMMFAILFGLSMDYEVFLMTHVRERWQATGDAHRAVIEGLA
FT                   GTARVITSAALIMVAVFLAFLLDGNPTIKQFGLGMAVAVAVDATVIRCLLVPAIMSLLG
FT                   RRAWWMPRRLERLTPRLSIEGDG"
     atgaagagca acgatcgcgg cggactgcac cggctcggcc gcttctgcgt ccgacgccac        60
     cgcctggtgc tgttggtgtg ggtcctcggc gccgtcgggc tcggcgtgtg ggccggacag       120
     ctcgggacgc agacgaacga caacgtctcg ctgcccggca ccgacagcca gcgcgctgcc       180
     gacgtgctgg accgcgactt ctccagcggc gcctcgaacg gcaccaaccc gatcgtgctg       240
     cgcgcgcccg cgggcgtgcg gctgaccgac gcggcggagc ggagagccgt caccgcgatc       300
     gccgccgcgt acgccagaga ccccggcgtc cgtgccgtcg tcagcccgct cgagccggcc       360
     ggcgcgtcgc agctgagccg cgacgcgcgg atcgggtatc tcgggctgtc gctgcgcgac       420
     agcccgagca cgctgacgct gtccgaggcg gagcgcctgc tctccgtcgc gcaggacgcg       480
     gcgcgcccgg ccgggctgca ggtcgccgcg ggcggctacc tcggcgccga cctgtcgcag       540
     gccggctcgg cggattccga ggcgatcggc ctgctggccg cggtcgtcgt cctgctcttc       600
     acgttcggga ccgtcgtcgc gatggggctc ccgctcctga ccgcgatcct cgggctcggc       660
     accgggctga gcctgatcac gctcgccagc cacgtcgtgc aggtgccgag caccgcgccg       720
     gcgctggcga cgatgatcgg tctcggtgtc gggatcgact acgcgctctt cgtcgtcacc       780
     cgccatcgcg agcagatggc cgccggcgtc gagctgcgcg agtcgatcgc gcgcgccgtc       840
     gcgacctccg gcagcgccgt cgtgttcgcc ggcgggacgg tcgtgatcgc gctgtgctcg       900
     ctgctgctga ccggcatccc gctcgtccag cagatgggct gcctcgccgc gatcgccgtg       960
     ctcgtcgcgg tgctcgcggc gatcacgctg ctgccggccg cgctcgcggc cgtcggaccg      1020
     cggatcgact cgctcgccct gccgtgggtg cggcgcgcac gccgcgaagc cgaggccgag      1080
     cgcgctcgcg ccgcgtccgc cggcgcgccg gccgccggaa gcgcagccgc ttccgccgcg      1140
     ccggcatccg acagcgcaac cgcttccgcc acttccgccg cttccgccgc acctgccagc      1200
     gccggcgccg ccgctcccgc tcacccgacc atgtggctgc gttgggcgcg cctggtcgcc      1260
     gaccggccgt ggccggcgct cgtcgtcgcg ctgctcgtgc tcggcgcgct cgcctggccg      1320
     ctgacgtcgc tcgacctcgg ccagagcgac accggccaac tgccgcgcga cacgaccgcg      1380
     cgccaggcct acgacatgct cgcggagggc ttcggcgccg gctccaacgg cccgctgctc      1440
     atcgccgtga gactgccggc cgacgccgcg agagcgagcg ccgaagcggt cgccgggaga      1500
     ctcgccgccg cgttgagagc gacgccgggc gtcgccgcgg tcggcccgcc gctgccggcg      1560
     ccgcgcggcg acgcgctgct gctgacgctg acgccgacga ccgcgccgtc ggcgccggcg      1620
     accgaggcgc tcgtccggca cctgcgcgcc gacacgatcc cggccgcgct gggcgacagc      1680
     ggcaccgccg ccttcgtcgg cggctcgacg gccggctaca tcgacctcgc cgacgagatc      1740
     agagaccgcc tcccgctcgt gatcgccgtc gtgctgacgc tctcgttcct gctgctgacg      1800
     ctcgccttcc gctcgctgat cgtgccgctg aaggcggtgc tgatgaacct gctctcgatc      1860
     ggcgcggcgt tcggcgtcgt ctcgttcgtc ttcagccacg actggagcgc gcagctgctc      1920
     ggggtcgagg gcgcagcgcc gatcgtctcg ttcgtcccgc tgatgatgtt cgcgatcctc      1980
     ttcggcctct cgatggacta tgaggtcttc ctgatgacgc acgtgcgcga gcgctggcag      2040
     gcgaccggcg acgcgcaccg cgccgtgatc gagggactgg ccgggaccgc gcgcgtgatc      2100
     acctcggcgg cgctgatcat ggtcgccgtc ttcctcgcgt tcctgctcga cggcaacccg      2160
     acgatcaagc agttcggcct cggcatggca gtcgcggtag cggtcgacgc gaccgtgatc      2220
     cgctgcctgc tcgtgccggc gatcatgtcg ctgctgggcc gccgcgcctg gtggatgccg      2280
     agacggctgg agcggctgac gccgcggctg tcgatagagg gcgacgggta g               2331
//

If you have problems or comments...

PBIL Back to PBIL home page