(data stored in ACNUC7421 zone)

EMBL: CP001854.PE205

CP001854.PE205       Location/Qualifiers
FT   CDS_pept        208126..208815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48641"
FT                   /db_xref="GOA:D3F563"
FT                   /db_xref="UniProtKB/TrEMBL:D3F563"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48641.1"
FT                   /translation="MSTSQPPQGGQGQPGPQQPGGADQPAAPRRRTFGAGALAGVAAAV
FT                   LVIAGVGGYLIGHSSGDDEGTKSGKQAGYQKGLEAGRAEVTAEYQRGQPAYKQIFDEGK
FT                   AKGFREGMAQGTAQGERTGEAQGERTGFEQGQRVGVSTGESEGVRQGAAAVLGGFQTWT
FT                   DGAFYIVTVGASQTEGVPYTITSRSQVEPGTNYKLCGGGGSSQICQTAATAATPSEDAG
FT                   GAGAPSE"
     atgtcgacga gtcaaccgcc gcagggcggt cagggccagc cgggaccgca gcagccggga        60
     ggggccgacc agccggccgc gccgagaaga cgcacgttcg gcgcgggtgc gctggcgggc       120
     gtcgccgcgg cggtgctcgt catcgccggc gtcggcggct acctgatcgg ccacagcagc       180
     ggcgacgacg aggggacgaa gtccggcaag caggccggct accagaaggg cctcgaggcg       240
     ggccgcgccg aggtgacggc cgagtatcag agaggccagc ccgcgtacaa gcagatcttc       300
     gacgagggca aggcgaaggg cttcagagag ggcatggcgc agggcaccgc ccagggcgag       360
     agaacgggcg aggcgcaggg cgagagaacc ggcttcgagc agggccagag agtcggcgtc       420
     tcgaccggcg agtccgaggg cgtcagacag ggcgccgccg cggtgctcgg cggcttccag       480
     acgtggaccg acggcgcctt ctacatcgtc acggtcggcg ccagccagac cgagggcgtg       540
     ccgtacacga tcaccagccg ctcgcaggtc gagccgggca cgaactacaa gctgtgcggc       600
     ggtggcggca gctcgcagat ctgccagacg gccgcgaccg cggcgacgcc gtcggaggac       660
     gccggcggcg ccggcgcgcc gagcgagtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page