(data stored in ACNUC7421 zone)

EMBL: CP001854.PE206

CP001854.PE206       Location/Qualifiers
FT   CDS_pept        208836..209639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0206"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /note="KEGG: mca:MCA1838 alpha-acetolactate decarboxylase;
FT                   TIGRFAM: alpha-acetolactate decarboxylase; PFAM:
FT                   alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48642"
FT                   /db_xref="GOA:D3F564"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:D3F564"
FT                   /inference="protein motif:TFAM:TIGR01252"
FT                   /protein_id="ADB48642.1"
FT                   /translation="MAVDPRLVAALHLETVRHGALEDEHAAHVAFQTSTLAALLDGAYD
FT                   GDLTIGELRRHGDLGLGTFQALDGEMVVLDGEVWRARVDGSVEPVGDDERTPFAVVTPF
FT                   AADVTVAVEHELTHAQLLALVERRAPAGAATRAIRFDGRLVAVHARSVPRQRRPYPPLA
FT                   EAAAQQRDFMLEAADGALVGFAFPDVAAGVELPGVHLHAITADRRRGGHVLSARVGPGV
FT                   LRIGALRDLHVELPPGVELPDAPDPGGSADDARAALLDRIERDPG"
     atggcggtcg acccgcggct cgtcgccgcg ctccacctcg agacggtccg gcacggcgcg        60
     ctcgaggacg agcacgccgc gcacgtcgcc ttccagacct cgacgctcgc ggcgctgctc       120
     gacggcgcct acgacggcga cctgacgatc ggcgagctcc gccgccacgg cgacctcggc       180
     ctcggtacct tccaggcgct cgacggcgag atggtcgtgc tcgacggcga ggtctggcgg       240
     gcgcgcgtcg acggctcggt cgagccggtc ggcgacgacg agcggacgcc gttcgcggtc       300
     gtgacgccgt tcgccgccga cgtgacggtc gcggtcgagc acgagctgac ccacgcgcag       360
     ctgctcgcgc tcgtcgagcg gcgtgcgccg gccggcgcgg ccacccgcgc gatccgcttc       420
     gacggccgcc tcgtcgcggt gcacgcgcgc tcggtcccgc gccagcgacg gccgtatccg       480
     ccgctcgcgg aggccgccgc gcagcagcgc gacttcatgc tggaggcggc cgacggcgca       540
     ctcgtcggct tcgccttccc tgacgtcgcg gccggggtcg agctgcccgg cgtccacctc       600
     cacgcgatca cggccgaccg ccgccgcggc ggccacgtgc tgagcgcgcg cgtcggcccc       660
     ggcgtgctgc ggatcggcgc gctgcgcgac ctccacgtcg agctgccgcc cggcgtcgag       720
     ctgcccgacg cgcccgatcc gggcggcagc gcggacgatg cccgcgccgc gctgctggac       780
     cggatcgagc gggaccccgg ctag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page